TkA08G077840 | RubberDandelionOmics

Gene overview

TkA08G077840

Reference: TK1151 Chr: Chr08 Coordinates: 19943619-19944986 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

873 bp · TkA08G077840|TK1151|cDNA

AACAAACCCCGGAATCAAGTGTACAAAACCCTAAACACGCTAACCCTAAATACAACACACACATCCCACCTTGCTGCGATTCTAGAGTCGGAGGCGTAGGAAGCGAGAGAGGTGAGGAAAAATGGTGTCAGGATCTGGAATATGCGCAAAGGAGGTGGTGGTTGACGCTCGCCACCATATGCTTGGCCGTCTATCGTCCATTTTGGCTAAAGAGCTTCTCAATGGGCAGAGAGTCACAGTCGTTCGATGTGAAGAAATCT...

CDS

Download CDS FASTA

621 bp · TkA08G077840|TK1151|CDS

ATGGTGTCAGGATCTGGAATATGCGCAAAGGAGGTGGTGGTTGACGCTCGCCACCATATGCTTGGCCGTCTATCGTCCATTTTGGCTAAAGAGCTTCTCAATGGGCAGAGAGTCACAGTCGTTCGATGTGAAGAAATCTGTCTTTCCGGCGGTCTCGTACGCCAGAAAATGAAGTACCTTCGTTTTCTTCGTAAGAGGATGAACACCAAGCCTTCTCACGGACCTATCCATTTTCGTGCTCCTTCTAAGATCCTCTGGCG...

Protein

Download Protein FASTA

206 aa · TkA08G077840|TK1151|PROTEIN

MVSGSGICAKEVVVDARHHMLGRLSSILAKELLNGQRVTVVRCEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALAKLKVYEGVPTPYNRKKRMVIPDALKVLRLTAGHKYCLLGRLSSEVGWNHYETIKDLEKKRKEKAQVVYERKKQLNKLRAKAEKAAEEKLGAQLEILAPVTY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G077840`
TK1151 ID	TkA08G077840
OH-1004 ID	LXL04_018679
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G077840

Location Chr08:19943619-19944986 (-)

Description Similar to RPL13AD: 60S ribosomal protein L13a-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48760`	Large ribosomal subunit protein uL13w.	No verified direct reference in this release
`At3g07110`	Large ribosomal subunit protein uL13z.	No verified direct reference in this release
`At4g13170`	Large ribosomal subunit protein uL13x.	No verified direct reference in this release
`At3g24830`	Large ribosomal subunit protein uL13y.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018679 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT3G07110

ath:AT3G24830

ath:AT4G13170

ath:AT5G48760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.615

Rank 1 · TkA08G077840 · TK1151

Mitochondrion0.199

Rank 2 · TkA08G077840 · TK1151

Nucleus0.180

Rank 3 · TkA08G077840 · TK1151

Endoplasmic reticulum0.028

Rank 4 · TkA08G077840 · TK1151

Plastid0.017

Rank 5 · TkA08G077840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00572Ribosomal_L1310-116 aa

PF20607DUF6800173-193 aa

PF00572Ribosomal_L13175-177 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G077840	`PF00572`	Ribosomal_L13	10	116	2.2e-21	76.9
TkA08G077840	`PF20607`	DUF6800	173	193	0.7	10.5
TkA08G077840	`PF00572`	Ribosomal_L13	175	177	2.2e-21	76.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKC0`	Arabidopsis thaliana	sp\|Q9FKC0\|R13A4_ARATH Large ribosomal subunit protein uL13w	88.300%	Swiss-Prot	High
`Q9SFU1`	Arabidopsis thaliana	sp\|Q9SFU1\|R13A1_ARATH Large ribosomal subunit protein uL13z	85.400%	Swiss-Prot	High
`Q9SVR0`	Arabidopsis thaliana	sp\|Q9SVR0\|R13A3_ARATH Large ribosomal subunit protein uL13x	84.500%	Swiss-Prot	High
`Q9LRX8`	Arabidopsis thaliana	sp\|Q9LRX8\|R13A2_ARATH Large ribosomal subunit protein uL13y	84.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card