TkA08G076390 | RubberDandelionOmics

Gene overview

TkA08G076390

Reference: TK1151 Chr: Chr08 Coordinates: 19613709-19614221 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

513 bp · TkA08G076390|TK1151|cDNA

ATGGCGAGACCAATCTTACAGCGACGCTCTCTCGCCTCCACTCTAACCGCATTTCTCAATCGCCGATCAATCTCCACCGTCGCCGTTGATGCACCCAGAAACCCCATTACCTCGATACCTCTGCCATCCCCACCACCACCACAAATCTCCAACCTGAGAACGAGAACTCCACTAGAGAAGCAATTCGAGACATGGCTCGAAAAGCTCAAACCCGGATTCACCCCATACGACGTGGACGAAGCATTACGTGCTCAATCCGA...

CDS

Download CDS FASTA

513 bp · TkA08G076390|TK1151|CDS

ATGGCGAGACCAATCTTACAGCGACGCTCTCTCGCCTCCACTCTAACCGCATTTCTCAATCGCCGATCAATCTCCACCGTCGCCGTTGATGCACCCAGAAACCCCATTACCTCGATACCTCTGCCATCCCCACCACCACCACAAATCTCCAACCTGAGAACGAGAACTCCACTAGAGAAGCAATTCGAGACATGGCTCGAAAAGCTCAAACCCGGATTCACCCCATACGACGTGGACGAAGCATTACGTGCTCAATCCGA...

Protein

Download Protein FASTA

170 aa · TkA08G076390|TK1151|PROTEIN

MARPILQRRSLASTLTAFLNRRSISTVAVDAPRNPITSIPLPSPPPPQISNLRTRTPLEKQFETWLEKLKPGFTPYDVDEALRAQSDADLAFDIFRWTGQQRGYKHNSTTYLTMVQIAVSGKRYYHAETLVEEIVAGACSGSVPLYNSVIKFCCGRKFLFNRAFDVYKKC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G076390`
TK1151 ID	TkA08G076390
OH-1004 ID	LXL04_018648
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.412 / OH-1004 44.709 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G076390

Location Chr08:19613709-19614221 (-)

Description Similar to At3g25210: Pentatricopeptide repeat-containing protein At3g25210, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25210`	Pentatricopeptide repeat-containing protein At3g25210, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018648 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006396 RNA processing Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G03560

ath:AT2G27800

ath:AT3G25210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.687

Rank 1 · TkA08G076390 · TK1151

Plastid0.188

Rank 2 · TkA08G076390 · TK1151

Nucleus0.068

Rank 3 · TkA08G076390 · TK1151

Cytoplasm0.028

Rank 4 · TkA08G076390 · TK1151

Cell membrane0.008

Rank 5 · TkA08G076390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041PPR_287-115 aa

PF13812PPR_3100-156 aa

PF13041PPR_2145-168 aa

PF06001RING_CBP-p300150-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G076390	`PF13041`	PPR_2	87	115	0.026	15.3
TkA08G076390	`PF13812`	PPR_3	100	156	0.12	13.1
TkA08G076390	`PF13041`	PPR_2	145	168	0.026	15.3
TkA08G076390	`PF06001`	RING_CBP-p300	150	161	0.095	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSF5`	Arabidopsis thaliana	sp\|Q9LSF5\|PP254_ARATH Pentatricopeptide repeat-containing protein At3g25210, mitochondrial	70.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card