Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1131 bp · TkA08G072450|TK1151|cDNA
ATGGACGAAAAAACCAAACTTTTACTACTTTCTTTACTCTTTCTCCTTGCAGCTCAAGGCGGAGACGGAGGTGGTGGTGGAAGAACCACCAGAAACGGGTCAAACCCATCAAGCCTCACCAATGCCTACATTGCCCTTCAAGCATGGAAGTCCGCCATTAAAGCTGACCCAAAAGGAATCTTCAACTCATGGGTCGGGTCAAATGTATGCGACTACAATGGAGTTTTCTGTCAAGATACATTAGTAACAGGAATAGACCT...
1131 bp · TkA08G072450|TK1151|CDS
ATGGACGAAAAAACCAAACTTTTACTACTTTCTTTACTCTTTCTCCTTGCAGCTCAAGGCGGAGACGGAGGTGGTGGTGGAAGAACCACCAGAAACGGGTCAAACCCATCAAGCCTCACCAATGCCTACATTGCCCTTCAAGCATGGAAGTCCGCCATTAAAGCTGACCCAAAAGGAATCTTCAACTCATGGGTCGGGTCAAATGTATGCGACTACAATGGAGTTTTCTGTCAAGATACATTAGTAACAGGAATAGACCT...
Protein
Download Protein FASTA376 aa · TkA08G072450|TK1151|PROTEIN
MDEKTKLLLLSLLFLLAAQGGDGGGGGRTTRNGSNPSSLTNAYIALQAWKSAIKADPKGIFNSWVGSNVCDYNGVFCQDTLVTGIDLNHGGVEGTLVKELSLLKDITLLHLNSNGFTGTIPDSLKDLFALTELDLSNNQFAGPFPAVILQIPNLVYLDLRFNLFSGPIPDLVFTKNLDAILLNNNKFQGQIPQSLANSPASVINLANNNLTGEIPISFGYSRHGLKEILFLNNQLSGCIPQGIGMWSDLQVFDASFNSLM...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G072450 |
|---|---|
| TK1151 ID | TkA08G072450 |
| OH-1004 ID | LXL04_002475 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 68.600 |
| Protein coverage (%) | TK1151 88.830 / OH-1004 56.486Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G072450 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:18693833-18694963 (-) | |||||||||
| Description | Similar to LRX4: Leucine-rich repeat extensin-like protein 4 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0071555 cell wall organization Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009506 plasmodesma Cellular Component GO:0099503 secretory vesicle Cellular Component GO:0005199 structural constituent of cell wall Molecular Function GO:0042277 peptide binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G62440 ath:AT3G24480 ath:AT4G13340 ath:AT4G18670 ath:AT5G25550 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08263LRRNT_245-77 aaPF23598LRR_1499-159 aaPF12799LRR_499-119 aaPF00560LRR_1107-127 aaPF13855LRR_8107-163 aaPF13516LRR_6107-118 aaPF12799LRR_4108-139 aaPF24141LRR_ComC108-138 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G072450 | PF08263 | LRRNT_2 | 45 | 77 | 1.9e-06 | 28.7 |
| TkA08G072450 | PF23598 | LRR_14 | 99 | 159 | 3.2e-07 | 30.1 |
| TkA08G072450 | PF12799 | LRR_4 | 99 | 119 | 1.4e-05 | 25.9 |
| TkA08G072450 | PF00560 | LRR_1 | 107 | 127 | 4.2e-21 | 71.2 |
| TkA08G072450 | PF13855 | LRR_8 | 107 | 163 | 3.5e-11 | 43.4 |
| TkA08G072450 | PF13516 | LRR_6 | 107 | 118 | 0.0012 | 19.4 |
| TkA08G072450 | PF12799 | LRR_4 | 108 | 139 | 1.4e-05 | 25.9 |
| TkA08G072450 | PF24141 | LRR_ComC | 108 | 138 | 0.0043 | 17.5 |
| TkA08G072450 | PF00560 | LRR_1 | 130 | 147 | 4.2e-21 | 71.2 |
| TkA08G072450 | PF12799 | LRR_4 | 130 | 163 | 1.4e-05 | 25.9 |
| TkA08G072450 | PF13516 | LRR_6 | 130 | 140 | 0.0012 | 19.4 |
| TkA08G072450 | PF24141 | LRR_ComC | 139 | 218 | 0.0043 | 17.5 |
| TkA08G072450 | PF13855 | LRR_8 | 152 | 210 | 3.5e-11 | 43.4 |
| TkA08G072450 | PF13516 | LRR_6 | 152 | 162 | 0.0012 | 19.4 |
| TkA08G072450 | PF00560 | LRR_1 | 153 | 171 | 4.2e-21 | 71.2 |
| TkA08G072450 | PF00560 | LRR_1 | 176 | 197 | 4.2e-21 | 71.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.