TkA08G069790 | RubberDandelionOmics

Gene overview

TkA08G069790

Reference: TK1151 Chr: Chr08 Coordinates: 17985924-17987301 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

984 bp · TkA08G069790|TK1151|cDNA

ATGCCCCCATTTCGCAGAGCATCTTATGTCACTTCCGTCACGAGCCAGTTTCGCAGAAGGTCATTTAATTTCGCAGAGATGGCTCTGCGAAATGCCACCTACGCCTGCGAAATGCCACAGCACCCTCTGCGAAATGGAGTTTTCTCTGCGAAATGGATGGCTATTTCAGGAATGTCTGGTTTTTTAGGCTATTTGGTGGAAGGTTTTTGTGGAATCTGGCTATTTCGGTCAATTTCTCTTGTTTCCGGCATTATCGTGGA...

CDS

Download CDS FASTA

984 bp · TkA08G069790|TK1151|CDS

ATGCCCCCATTTCGCAGAGCATCTTATGTCACTTCCGTCACGAGCCAGTTTCGCAGAAGGTCATTTAATTTCGCAGAGATGGCTCTGCGAAATGCCACCTACGCCTGCGAAATGCCACAGCACCCTCTGCGAAATGGAGTTTTCTCTGCGAAATGGATGGCTATTTCAGGAATGTCTGGTTTTTTAGGCTATTTGGTGGAAGGTTTTTGTGGAATCTGGCTATTTCGGTCAATTTCTCTTGTTTCCGGCATTATCGTGGA...

Protein

Download Protein FASTA

327 aa · TkA08G069790|TK1151|PROTEIN

MPPFRRASYVTSVTSQFRRRSFNFAEMALRNATYACEMPQHPLRNGVFSAKWMAISGMSGFLGYLVEGFCGIWLFRSISLVSGIIVETNNKSENYINEFAPSSGSKYIDLSFLPHNARIKASSEHGIVVFETSDSKSYGLNSYYVCKPATKQDKLYTAYRCEIFNSRTWSWKLQNLLKLPFRVFPTYPQPITARGSIYMLLTNNNILKFDAYSEIWSIFLSPVSDHRGYEFRQLVKYEGRLGFGCKRLDGSWEIWVLGIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G069790`
TK1151 ID	TkA08G069790
OH-1004 ID	LXL04_018589
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	83.600
Protein coverage (%)	TK1151 75.841 / OH-1004 85.380 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G069790`
Location	Chr08:17985924-17987301 (+)
Description	Similar to At5g41720: F-box protein At5g41720
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018589` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	ath:AT5G41720 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.496

Rank 1 · TkA08G069790 · TK1151

Cytoplasm0.366

Rank 2 · TkA08G069790 · TK1151

Cell membrane0.145

Rank 3 · TkA08G069790 · TK1151

Endoplasmic reticulum0.086

Rank 4 · TkA08G069790 · TK1151

Extracellular0.047

Rank 5 · TkA08G069790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30649ABC1_C52-78 aa

PF08268FBA_3119-152 aa

PF23635Beta-prop_AT5G49610-like136-219 aa

PF08268FBA_3178-294 aa

PF23635Beta-prop_AT5G49610-like291-312 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G069790	`PF30649`	ABC1_C	52	78	0.21	12.0
TkA08G069790	`PF08268`	FBA_3	119	152	5.4e-06	26.4
TkA08G069790	`PF23635`	Beta-prop_AT5G49610-like	136	219	0.075	12.9
TkA08G069790	`PF08268`	FBA_3	178	294	5.4e-06	26.4
TkA08G069790	`PF23635`	Beta-prop_AT5G49610-like	291	312	0.075	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card