TkA08G068880 | RubberDandelionOmics

Gene overview

TkA08G068880

Reference: TK1151 Chr: Chr08 Coordinates: 17733807-17735210 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1135 bp · TkA08G068880|TK1151|cDNA

AATAAAAAAGGGGAATAAGGTGGGGCCATTGAAGTTGCCAAGAACACGACTCCATGCCAATGCTTTTCAAGATTCATCAACACTATATATCTCACAAGCCTATTAATCATATTTCCTCAATTTAAACACCTTCAATTTACAGATTCTTTGTAGGGTTTAATTGCTCTTTATTTTCCTTTTCCTTTTCATTGTTCTTGATATTATGTCTGCTTCGTCGGAAATCGTGGATTCCGGTAGATTTTCCGGCCAAATTACGCCAT...

CDS

Download CDS FASTA

615 bp · TkA08G068880|TK1151|CDS

ATGTCTGCTTCGTCGGAAATCGTGGATTCCGGTAGATTTTCCGGCCAAATTACGCCATCCAGAGCTCTGGATAAGTCCAATTTCTCCCAGACTTGTAATCTGTTCTCTCAGTACTTGAAGGAAAACGCTACTTTCCCAGATCTAACTCTCGGTCGGAGAACAACACCATCAACTCCCACCATGAATCTTTTTCCGATAGCTGAAAAAACCCCACGATCGGCAGCGGTACAGCCGCAAACCACCGCCGGGCAGACTCAATC...

Protein

Download Protein FASTA

204 aa · TkA08G068880|TK1151|PROTEIN

MSASSEIVDSGRFSGQITPSRALDKSNFSQTCNLFSQYLKENATFPDLTLGRRTTPSTPTMNLFPIAEKTPRSAAVQPQTTAGQTQSTPMTIFYNGQVMVFNDLSPEKVKEILMIAGKGVPQKPTKPEELSNTIVHDSIKIQRSQPVVADLPIARKASLARFLEKRKDRITARSPYQTQGESKQEDSKTWLGLGAQSNVQFQQR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G068880`
TK1151 ID	TkA08G068880
OH-1004 ID	LXL04_018574
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.078 / OH-1004 57.988 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G068880

Location Chr08:17733807-17735210 (-)

Description Similar to TIFY10A: Protein TIFY 10A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g19180`	Repressor of jasmonate responses.	No verified direct reference in this release
`At1g74950`	Repressor of jasmonate responses.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0402800`	Repressor of jasmonate responses (By similarity).	No verified direct reference in this release
`Os07g0615200`	Repressor of jasmonate responses.	No verified direct reference in this release
`UniProt: A2YNP2`	Repressor of jasmonate responses.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018574 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:1900067 regulation of cellular response to alkaline pH Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G19180

ath:AT1G74950

dosa:Os03g0402800

dosa:Os07g0615200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.813

Rank 1 · TkA08G068880 · TK1151

Cytoplasm0.244

Rank 2 · TkA08G068880 · TK1151

Cell membrane0.095

Rank 3 · TkA08G068880 · TK1151

Endoplasmic reticulum0.061

Rank 4 · TkA08G068880 · TK1151

Plastid0.023

Rank 5 · TkA08G068880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06200tify86-117 aa

PF09425Jas_motif152-177 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G068880	`PF06200`	tify	86	117	1.1e-15	57.3
TkA08G068880	`PF09425`	Jas_motif	152	177	2.2e-15	56.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMA8`	Arabidopsis thaliana	sp\|Q9LMA8\|TI10A_ARATH Protein TIFY 10A	36.400%	Swiss-Prot	Medium
`Q9S7M2`	Arabidopsis thaliana	sp\|Q9S7M2\|TI10B_ARATH Protein TIFY 10B	39.800%	Swiss-Prot	Medium
`Q84R94`	Oryza sativa subsp. japonica	sp\|Q84R94\|TI10A_ORYSJ Protein TIFY 10a	34.500%	Swiss-Prot	Medium
`Q8H395`	Oryza sativa subsp. japonica	sp\|Q8H395\|TI10B_ORYSJ Protein TIFY 10b	35.100%	Swiss-Prot	Medium
`A2YNP2`	Oryza sativa subsp. indica	sp\|A2YNP2\|TI10B_ORYSI Protein TIFY 10b	34.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card