TkA08G068220 | RubberDandelionOmics

Gene overview

TkA08G068220

Reference: TK1151 Chr: Chr08 Coordinates: 17513197-17516079 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1488 bp · TkA08G068220|TK1151|cDNA

CAACTTCCCACGCAACATTAGGGTTTTACAGGGGTTTCTCCCCTCTTCGATGAAAGACGCTCACGACCAAATCGTATGAATCATCTACGAATTTAATTCCCAAGTTTTACCTTTTTCAAGTATTCTGAGTGTTACCAGTTTTCATCGCACAAATTGCTGTCGATGGAAGCTCAAGTGGGGATGTCTAGTCACGGCGGAGTCGTGGACGGCCCTACCGCGGTGAAGTTTTTACAAAAGCAGCAGACGGTGGCGCCGTCTCC...

CDS

Download CDS FASTA

1038 bp · TkA08G068220|TK1151|CDS

ATGGAAGCTCAAGTGGGGATGTCTAGTCACGGCGGAGTCGTGGACGGCCCTACCGCGGTGAAGTTTTTACAAAAGCAGCAGACGGTGGCGCCGTCTCCTTCCCCACGTCAACACCAACATCAGCAGTCAGCGGAGATAGGCACGGTACCACAGCTTCTAGCTGGCGGTATTGCTGGTGCTTTTAGCAAAACATGCACGGCTCCACTCGCACGCCTCACTATTCTCTTTCAGGTGCAAGGTATGCATTCTGAGGTAGCACT...

Protein

Download Protein FASTA

345 aa · TkA08G068220|TK1151|PROTEIN

MEAQVGMSSHGGVVDGPTAVKFLQKQQTVAPSPSPRQHQHQQSAEIGTVPQLLAGGIAGAFSKTCTAPLARLTILFQVQGMHSEVALLTRPCIWNEALRIANEEGFRAFWKGNLVTIAHRLPYTAVNFYAYEQFKKLLKSAPRIGNNSESAAAEACVHFVGGGMSGITAAMATYPLDLVRTRLAAQRSTIYYHGIGHALRTIIRDEGCIGLYKGLGATLLGVGPSIAISFSVYEMLRSNWKLHRPDDSTVMVSLACGSLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G068220`
TK1151 ID	TkA08G068220
OH-1004 ID	LXL04_018560
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 95.568 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G068220`
Location	Chr08:17513197-17516079 (-)
Description	Similar to mcfB: Mitochondrial substrate carrier family protein B
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018560` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006839 mitochondrial transport Biological Process GO:0015866 ADP transport Biological Process GO:0015867 ATP transport Biological Process GO:0034599 cellular response to oxidative stress Biological Process GO:0051503 adenine nucleotide transport Biological Process GO:0071277 cellular response to calcium ion Biological Process GO:1990544 mitochondrial ATP transmembrane transport Biological Process GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0016020 membrane Cellular Component GO:0000295 adenine nucleotide transmembrane transporter activity Molecular Function GO:0005347 ATP transmembrane transporter activity Molecular Function
KEGG gene cross-reference	ddi:DDB_G0285599 hsa:29957 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.902

Rank 1 · TkA08G068220 · TK1151

Cytoplasm0.048

Rank 2 · TkA08G068220 · TK1151

Nucleus0.032

Rank 3 · TkA08G068220 · TK1151

Cell membrane0.023

Rank 4 · TkA08G068220 · TK1151

Plastid0.022

Rank 5 · TkA08G068220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153Mito_carr48-139 aa

PF18405SLC25_like51-70 aa

PF18405SLC25_like155-178 aa

PF00153Mito_carr156-240 aa

PF18405SLC25_like247-277 aa

PF00153Mito_carr248-342 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G068220	`PF00153`	Mito_carr	48	139	7.1e-74	244.4
TkA08G068220	`PF18405`	SLC25_like	51	70	0.53	10.0
TkA08G068220	`PF18405`	SLC25_like	155	178	0.53	10.0
TkA08G068220	`PF00153`	Mito_carr	156	240	7.1e-74	244.4
TkA08G068220	`PF18405`	SLC25_like	247	277	0.53	10.0
TkA08G068220	`PF00153`	Mito_carr	248	342	7.1e-74	244.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card