TkA08G068200 | RubberDandelionOmics

Gene overview

TkA08G068200

Reference: TK1151 Chr: Chr08 Coordinates: 17502608-17503679 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

713 bp · TkA08G068200|TK1151|cDNA

GCACTCGATCGGTCTCCCCATATACCATACACACATCCAATACAGTCAAGAACGACGTCTTACACCCTGTTCCCGAGTGAATTTTCAGGAGGGAAAGGGAAGGATATAGACGGAAGGGGCGGGAAGGGGAGGGAAGGAGGAATCGTTCGTGTTCCGGAGAAAAGAAAAGCGGATGGATTACGATGGAAAGCGAGGGTTACGGAAGTGATAGAATCCCTCTTAACTTTCCTCCCAAATCGGGGGGATAAGGAGGGAGATTA...

CDS

Download CDS FASTA

600 bp · TkA08G068200|TK1151|CDS

GCACTCGATCGGTCTCCCCATATACCATACACACATCCAATACAGTCAAGAACGACGTCTTACACCCTGTTCCCGAGTGAATTTTCAGGAGGGAAAGGGAAGGATATAGACGGAAGGGGCGGGAAGGGGAGGGAAGGAGGAATCGTTCGTGTTCCGGAGAAAAGAAAAGCGGATGGATTACGATGGAAAGCGAGGGTTACGGAAGTGATAGAATCCCTCTTAACTTTCCTCCCAAATCGGGGGGATAAGGAGGGAGATTA...

Protein

Download Protein FASTA

199 aa · TkA08G068200|TK1151|PROTEIN

ALDRSPHIPYTHPIQSRTTSYTLFPSEFSGGKGKDIDGRGGKGREGGIVRVPEKRKADGLRWKARVTEVIESLLTFLPNRGDKEGDYLTSHPIFASIINRLPVFISHPTKSYFCCCVLQHWDSFSAALRCCGVLHSNYSGIVVVISVGLFLKFSSSKNSVYLGLVKIVITRGSWYFLESCRPKSAGGISLYANSCNTYI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G068200`
TK1151 ID	TkA08G068200
OH-1004 ID	LXL04_006594
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	59.100
Protein coverage (%)	TK1151 22.111 / OH-1004 13.293 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G068200`
Location	Chr08:17502608-17503679 (+)
Description	Similar to ASHH1: Histone-lysine N-methyltransferase ASHH1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006594` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006281 DNA repair Biological Process GO:0006302 double-strand break repair Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0009553 embryo sac development Biological Process GO:0009555 pollen development Biological Process GO:0009908 flower development Biological Process GO:0009910 negative regulation of flower development Biological Process GO:0010223 secondary shoot formation Biological Process GO:0010224 response to UV-B Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process
KEGG gene cross-reference	ath:AT1G76710 ath:AT1G77300 hsa:7468 mmu:107823 ncr:NCU00269 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.427

Rank 1 · TkA08G068200 · TK1151

Nucleus0.393

Rank 2 · TkA08G068200 · TK1151

Mitochondrion0.144

Rank 3 · TkA08G068200 · TK1151

Cell membrane0.100

Rank 4 · TkA08G068200 · TK1151

Endoplasmic reticulum0.077

Rank 5 · TkA08G068200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25328PH_MADD135-185 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G068200	`PF25328`	PH_MADD	135	185	0.071	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card