TkA08G067680 | RubberDandelionOmics

Gene overview

TkA08G067680

Reference: TK1151 Chr: Chr08 Coordinates: 17376100-17376758 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

510 bp · TkA08G067680|TK1151|cDNA

ATGCCTTTTTCAGAGACCGAAGCTGAGTACATTTCAAATCTTGATCCGTTTAAAGATGCTGAGCTTTTACGAACCGAACTTCCTTTAATCCGGGAATGCTCTGTACGCGTATTTATCCTGTGTACGATTTTCTTGAAAAAGGCGACATGTGCGGGACTTTCTCTCGCGGATATCGGTCAAATGATGACTCGCGAGTTTATCGGAGGTGAAGAACATTGGAGTATTTTGGAAATCATTTGCATGAATGCGAAAGCTAAATT...

CDS

Download CDS FASTA

510 bp · TkA08G067680|TK1151|CDS

ATGCCTTTTTCAGAGACCGAAGCTGAGTACATTTCAAATCTTGATCCGTTTAAAGATGCTGAGCTTTTACGAACCGAACTTCCTTTAATCCGGGAATGCTCTGTACGCGTATTTATCCTGTGTACGATTTTCTTGAAAAAGGCGACATGTGCGGGACTTTCTCTCGCGGATATCGGTCAAATGATGACTCGCGAGTTTATCGGAGGTGAAGAACATTGGAGTATTTTGGAAATCATTTGCATGAATGCGAAAGCTAAATT...

Protein

Download Protein FASTA

169 aa · TkA08G067680|TK1151|PROTEIN

MPFSETEAEYISNLDPFKDAELLRTELPLIRECSVRVFILCTIFLKKATCAGLSLADIGQMMTREFIGGEEHWSILEIICMNAKAKLDVDSKKNEVKGDNDEEIFEFDDKLNININDDVAMHPVLSKPEIKEEEWTLFMEYFEELLPEAFEEKKSTSLFKQRLGGSCEF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G067680`
TK1151 ID	TkA08G067680
OH-1004 ID	LXL04_018549
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	76.300
Protein coverage (%)	TK1151 100.000 / OH-1004 42.115 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G067680

Location Chr08:17376100-17376758 (+)

Description Similar to PI4KG8: Phosphatidylinositol 4-kinase gamma 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56600`	The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3).	No verified direct reference in this release
`At2g40850`	The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3).	No verified direct reference in this release
`At2g03890`	The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3) (By similarity).	Characterization of a new family of protein kinases from Arabidopsis containing phosphoinositide 3/4-kinase and ubiquitin-like domains.2008 · DOI: 10.1042/bj20070959
`At1g13640`	The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3).	No verified direct reference in this release
`At1g26270`	The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018549 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0046777 protein autophosphorylation Biological Process

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005829 cytosol Cellular Component

GO:0004430 1-phosphatidylinositol 4-kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0043424 protein histidine kinase binding Molecular Function

KEGG gene cross-reference

ath:AT1G26270

ath:AT2G03890

ath:AT2G40850

ath:AT3G56600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.465

Rank 1 · TkA08G067680 · TK1151

Cytoplasm0.431

Rank 2 · TkA08G067680 · TK1151

Mitochondrion0.105

Rank 3 · TkA08G067680 · TK1151

Cell membrane0.078

Rank 4 · TkA08G067680 · TK1151

Endoplasmic reticulum0.049

Rank 5 · TkA08G067680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00454PI3_PI4_kinase1-54 aa

PF00454PI3_PI4_kinase112-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G067680	`PF00454`	PI3_PI4_kinase	1	54	0.0015	19.2
TkA08G067680	`PF00454`	PI3_PI4_kinase	112	140	0.0015	19.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WMZ6`	Arabidopsis thaliana	sp\|Q0WMZ6\|P4KG8_ARATH Phosphatidylinositol 4-kinase gamma 8	50.400%	Swiss-Prot	High
`O22199`	Arabidopsis thaliana	sp\|O22199\|P4KG1_ARATH Phosphatidylinositol 4-kinase gamma 1	51.700%	Swiss-Prot	Medium
`Q9SI52`	Arabidopsis thaliana	sp\|Q9SI52\|P4KG7_ARATH Phosphatidylinositol 4-kinase gamma 7	52.300%	Swiss-Prot	Medium
`Q8W4R8`	Arabidopsis thaliana	sp\|Q8W4R8\|P4KG6_ARATH Phosphatidylinositol 4-kinase gamma 6	53.200%	Swiss-Prot	Medium
`Q9C671`	Arabidopsis thaliana	sp\|Q9C671\|P4KG5_ARATH Phosphatidylinositol 4-kinase gamma 5	48.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card