Gene Card
Gene overview
cDNA / CDS / Protein Sequences
336 bp · TkA08G067660|TK1151|cDNA
ATGCCGACTCCAATCTTACTCTCACTTGGATCCCTTCCCACCATGCTTGATTTCACACATCCCTCAAATCTCACCTCTAATTTCCACAAAAGCTATTCCACCCCATGCCTTTCCCTAAACCAAGAGTTTGAATCCCCAAACCCTAGAATCGAAATCATCAGTGGCCGTAAGGCACCCATGGTTCACGCCCTTGTAGCCGAGGTTGCAATCGCGTTAGCCTCCGGGGTCAAACCCAACCTGTGTCGAGTGGACTCGGTGGG...
336 bp · TkA08G067660|TK1151|CDS
ATGCCGACTCCAATCTTACTCTCACTTGGATCCCTTCCCACCATGCTTGATTTCACACATCCCTCAAATCTCACCTCTAATTTCCACAAAAGCTATTCCACCCCATGCCTTTCCCTAAACCAAGAGTTTGAATCCCCAAACCCTAGAATCGAAATCATCAGTGGCCGTAAGGCACCCATGGTTCACGCCCTTGTAGCCGAGGTTGCAATCGCGTTAGCCTCCGGGGTCAAACCCAACCTGTGTCGAGTGGACTCGGTGGG...
Protein
Download Protein FASTA111 aa · TkA08G067660|TK1151|PROTEIN
MPTPILLSLGSLPTMLDFTHPSNLTSNFHKSYSTPCLSLNQEFESPNPRIEIISGRKAPMVHALVAEVAIALASGVKPNLCRVDSVGPTIYNREKGTLSRLLNQPMKNTSV
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G067660 |
|---|---|
| TK1151 ID | TkA08G067660 |
| OH-1004 ID | LXL04_018549 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 61.300 |
| Protein coverage (%) | TK1151 92.793 / OH-1004 23.846Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G067660 |
|---|---|
| Location | Chr08:17375272-17375607 (+) |
| Description | Similar to PI4KG8: Phosphatidylinositol 4-kinase gamma 8 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0046777 protein autophosphorylation Biological Process GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:0005829 cytosol Cellular Component GO:0004430 1-phosphatidylinositol 4-kinase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0043424 protein histidine kinase binding Molecular Function |
| KEGG gene cross-reference | ath:AT1G26270 ath:AT2G03890 ath:AT2G40850 ath:AT3G56600 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.