TkA08G067650 | RubberDandelionOmics

Gene overview

TkA08G067650

Reference: TK1151 Chr: Chr08 Coordinates: 17364980-17370554 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3413 bp · TkA08G067650|TK1151|cDNA

ATTGTCAGCAAGACACGTACCAAAAGAGCGCAAACTCCCACGAGCCTCATGATTCATGAATATACAGGCAGATGAGATCCCCCCTCAGTCACTCTCCCGTGAAAGCTCCTTTATTGACGTTTCCTTTTTTGCCATAATATCTTCTTTGTCAATTCGCAACCCACACTCATTGTGGCTACCTTTCTCTAATCTCTATTTCGTTTCTTTCTTTGGTCAATATTCAATTGCTTTCAGATATTCACTCACACCGACTTGCATAC...

CDS

Download CDS FASTA

2883 bp · TkA08G067650|TK1151|CDS

ATGGTGAATTTAGGGTTGTTCTCCGACATCAAGCCTCTAATATCAGTGAATGTAAGATTCAGGATACCCTATTACACTCAGTGGGGTCAGAGTTTGGTTGTGTGCGGCTCTGAACCAGTTCTAGGTTCTGGAAATGTGAAGAAAGGGCTTCTTTTGACCCCTTTTCATGAAGGCGATGAATTGATATGGGGTGGAAGTTTATCAGTTCCAGCTGGGTTTAAAACAGAGTACAACTATTACGTAGTGGATGATGAAAGGAA...

Protein

Download Protein FASTA

960 aa · TkA08G067650|TK1151|PROTEIN

MVNLGLFSDIKPLISVNVRFRIPYYTQWGQSLVVCGSEPVLGSGNVKKGLLLTPFHEGDELIWGGSLSVPAGFKTEYNYYVVDDERNVLRWEAGNKRQLVLPDGVQNGKVLELHDLWQNGSDSLPSKSAFKNVIFRRSTELPIEKPPGTIVNKLDQEDSVIVQFKICCPNIAEGTSIYVIGSSMELGKWKVNDGLKLSYVGESIWEGDSLLPKTAFPLKYKYCKYGKNKNGNFSLEYGSNRELIVDTSASGPNYIFLSDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G067650`
TK1151 ID	TkA08G067650
OH-1004 ID	LXL04_014154
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	26.900
Protein coverage (%)	TK1151 31.354 / OH-1004 7.889 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G067650

Location Chr08:17364980-17370554 (+)

Description Similar to DPEP: 4-alpha-glucanotransferase, chloroplastic/amyloplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40840`	Cytosolic alpha-glucanotransferase essential for the cytosolic metabolism of maltose, an intermediate on the pathway by which starch is converted to sucrose in leaves at night.	A cytosolic glucosyltransferase is required for conversion of starch to sucrose in Arabidopsis leaves at night.2004 · DOI: 10.1111/j.1365-313x.2003.02012.x A transglucosidase necessary for starch degradation and maltose metabolism in leaves at night acts on cytosolic heteroglycans (SHG).2006 · DOI: 10.1111/j.1365-313x.2006.02732.x Proteomics analysis reveals post-translational mechanisms for cold-induced metabolic changes in Arabidopsis.2011 · DOI: 10.1093/mp/ssq078 Starch-related cytosolic heteroglycans in roots from Arabidopsis thaliana.2011 · DOI: 10.1016/j.jplph.2010.12.008

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0662900`	Cytosolic alpha-glucanotransferase essential for the cytosolic metabolism of maltose, an intermediate on the pathway by which starch is converted to sucrose in leaves at night.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014154 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000025 maltose catabolic process Biological Process

GO:0000272 polysaccharide catabolic process Biological Process

GO:0005983 starch catabolic process Biological Process

GO:0006006 glucose metabolic process Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0075523 viral translational frameshifting Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009501 amyloplast Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G64860

dosa:Os07g0627000

sce:YIL082W-A

sot:102595076

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.347

Rank 1 · TkA08G067650 · TK1151

Plastid0.267

Rank 2 · TkA08G067650 · TK1151

Mitochondrion0.164

Rank 3 · TkA08G067650 · TK1151

Nucleus0.135

Rank 4 · TkA08G067650 · TK1151

Peroxisome0.086

Rank 5 · TkA08G067650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00686CBM_2016-107 aa

PF00686CBM_20160-250 aa

PF02446Glyco_hydro_77274-902 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G067650	`PF00686`	CBM_20	16	107	1.7e-36	124.6
TkA08G067650	`PF00686`	CBM_20	160	250	1.7e-36	124.6
TkA08G067650	`PF02446`	Glyco_hydro_77	274	902	2.8e-143	478.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXD9`	Arabidopsis thaliana	sp\|Q8RXD9\|DPE2_ARATH 4-alpha-glucanotransferase DPE2	72.700%	Swiss-Prot	High
`Q69Q02`	Oryza sativa subsp. japonica	sp\|Q69Q02\|DPE2_ORYSJ 4-alpha-glucanotransferase DPE2	69.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card