TkA08G065450 | RubberDandelionOmics

Gene overview

TkA08G065450

Reference: TK1151 Chr: Chr08 Coordinates: 16734352-16740385 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2569 bp · TkA08G065450|TK1151|cDNA

CAAGATTGTCAAGGCTATAGTGGTGGCTCTCATTAAATCTATTTGGATTCACAGAAATGACATCATTTTCAACAATAATAGGGTGGAAAAGAAGATTGTTTTGAGGAGAATGCAAGAATTTCCCTTTTTTTGTTTTTTGACCGGTTTGAATGGGAGTTTCTTTTTGTTGCAACAAATCGAAAACGCACACAGAAAGCAAGAACGATGGCGAGCAGCAAACCAACGGAAATCGGCAGCTCAAAAATGTTTGAAGGTTTCAA...

CDS

Download CDS FASTA

2205 bp · TkA08G065450|TK1151|CDS

ATGGCGAGCAGCAAACCAACGGAAATCGGCAGCTCAAAAATGTTTGAAGGTTTCAACAAACGATACAAGCATGACTCACCGACCCTCGGTTGCTCCATGAACTTCCACATCTATTTCCCTCCCTCAACTTCTCCTGACCAAAGATTCCCTGTACTATACTGGCTCTCTGGTCTTACTTGCAACGATGAAAACTTCATTATCAAGTCAGGTGCTCAGCGAGTTGCATCAACTGAAGGCATCGCTTTGATTGTTCCAGATAC...

Protein

Download Protein FASTA

734 aa · TkA08G065450|TK1151|PROTEIN

MASSKPTEIGSSKMFEGFNKRYKHDSPTLGCSMNFHIYFPPSTSPDQRFPVLYWLSGLTCNDENFIIKSGAQRVASTEGIALIVPDTSPRGLNVEGEADSYDFGVGAGFYLNATVDKWKNWQMYDYIVKELPKVLSDNFPQLDTSRASISGHSMGGHGALTIYLKNLDKYKSVSAFAPIVNPINCPWGQKAFTNYLGDDKTAWEEYDATCLIKKFNDVAATIMIDQGDDDKFLHENQLLPSKFDEACRNVKAPLLLRMQP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G065450`
TK1151 ID	TkA08G065450
OH-1004 ID	LXL04_007958
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	65.400
Protein coverage (%)	TK1151 31.471 / OH-1004 39.780 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G065450

Location Chr08:16734352-16740385 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41530`	Serine hydrolase which catalyzes the hydrolysis of S-formylglutathione to glutathione and formic acid (Probable).	Cloning and characterization of an S-formylglutathione hydrolase from Arabidopsis thaliana.2002 · DOI: 10.1006/abbi.2002.2772 Unique regulation of the active site of the serine esterase S-formylglutathione hydrolase.2006 · DOI: 10.1016/j.jmb.2006.03.048

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007958 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.678

Rank 1 · TkA08G065450 · TK1151

Nucleus0.448

Rank 2 · TkA08G065450 · TK1151

Mitochondrion0.068

Rank 3 · TkA08G065450 · TK1151

Cell membrane0.041

Rank 4 · TkA08G065450 · TK1151

Endoplasmic reticulum0.038

Rank 5 · TkA08G065450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00756Esterase26-278 aa

PF00326Peptidase_S9112-266 aa

PF07224Chlorophyllase123-177 aa

PF12740PETase124-178 aa

PF12146Hydrolase_4131-194 aa

PF01738DLH140-266 aa

PF11887Mce4_CUP1349-375 aa

PF14942Muted353-425 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G065450	`PF00756`	Esterase	26	278	3.6e-59	201.3
TkA08G065450	`PF00326`	Peptidase_S9	112	266	1.4e-08	35.2
TkA08G065450	`PF07224`	Chlorophyllase	123	177	0.047	13.2
TkA08G065450	`PF12740`	PETase	124	178	0.015	15.5
TkA08G065450	`PF12146`	Hydrolase_4	131	194	0.016	15.3
TkA08G065450	`PF01738`	DLH	140	266	0.22	11.8
TkA08G065450	`PF11887`	Mce4_CUP1	349	375	0.14	12.4
TkA08G065450	`PF14942`	Muted	353	425	0.065	14.1
TkA08G065450	`PF01738`	DLH	496	526	0.22	11.8
TkA08G065450	`PF14942`	Muted	525	550	0.065	14.1
TkA08G065450	`PF12740`	PETase	590	611	0.015	15.5
TkA08G065450	`PF11887`	Mce4_CUP1	618	671	0.14	12.4
TkA08G065450	`PF14942`	Muted	619	689	0.065	14.1
TkA08G065450	`PF00326`	Peptidase_S9	652	689	1.4e-08	35.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LAS8`	Arabidopsis thaliana	sp\|Q8LAS8\|SFGH_ARATH S-formylglutathione hydrolase	80.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card