TkA08G065120 | RubberDandelionOmics

Gene overview

TkA08G065120

Reference: TK1151 Chr: Chr08 Coordinates: 16625437-16630683 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3931 bp · TkA08G065120|TK1151|cDNA

CACCAAATCAAAGTAAATTTACTGAACACTGAAGCAAACAAAAAATTGAATTATGACAAATCATAATATCGAAAATTGTTATGGAAGTAATTCAAAAGCATTTGTAATGCCTCTCGTTAACCCTTGAATTCCCTCCCTTTACTTTCTTTAAAACAGAGCCGAGTATCGGATTGGTAGCAATACAATTTGTTCAGGTGGGGAAAAGAAGAAAAGCTAAACTGAAATTAACTCACCGCCCATCGCCTCACCTGCGCCACCGG...

CDS

Download CDS FASTA

3330 bp · TkA08G065120|TK1151|CDS

ATGTCACTTGCACTCGAAGATTTTTTGTCCTCATCATCGTCCTCCACACAACGTTCGTTTTTCCAAAACCCTAACCCTAGCGCTCAGGGACATTTTACTGATTCAGGTATACTCAATAGTAGTTTCAATCTCATGAGTTCTCGTAAATTTGATTTTGATTGTTCAAATGACGCGGCGGCCAATGTTCGTTCTTCGAGGAGGAAGCACGTAAAAGTGAAGAAACAATCGAGTTGTAATGGTTCAGTGAGTAAAAAACCTTT...

Protein

Download Protein FASTA

1109 aa · TkA08G065120|TK1151|PROTEIN

MSLALEDFLSSSSSSTQRSFFQNPNPSAQGHFTDSGILNSSFNLMSSRKFDFDCSNDAAANVRSSRRKHVKVKKQSSCNGSVSKKPFNKAGDTTGFVFNATTSGSVLSSSLGQTGCDGNGERRRDGEVLDANLLRFTMGAGNGKLGNKMGSEEVHNSTNSFQPDRTNFVFGAGDKKADSRKASENVANKFGKLNGMDFVFGMKLNNGVGNSSSSNIGHESGPDGVAFHVSDSESSGAVGRSGINEFMKVKNFTTMADSHL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G065120`
TK1151 ID	TkA08G065120
OH-1004 ID	LXL04_018499
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G065120`
Location	Chr08:16625437-16630683 (+)
Description	Similar to DNAJC7: DnaJ homolog subfamily C member 7
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018499` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:0006970 response to osmotic stress Biological Process GO:1900034 regulation of cellular response to heat Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005856 cytoskeleton Cellular Component GO:0016020 membrane Cellular Component GO:0045335 phagocytic vesicle Cellular Component GO:0070062 extracellular exosome Cellular Component GO:0001671 ATPase activator activity Molecular Function
KEGG gene cross-reference	ath:AT3G58620 ddi:DDB_G0288639 hsa:7266 mmu:56354 pon:100173101 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.563

Rank 1 · TkA08G065120 · TK1151

Cytoplasm0.383

Rank 2 · TkA08G065120 · TK1151

Cell membrane0.067

Rank 3 · TkA08G065120 · TK1151

Endoplasmic reticulum0.048

Rank 4 · TkA08G065120 · TK1151

Plastid0.031

Rank 5 · TkA08G065120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13431TPR_17294-309 aa

PF25575TPR_BSK1_C586-668 aa

PF29407CFAP70_TPR_C588-620 aa

PF00515TPR_1589-617 aa

PF07719TPR_2589-617 aa

PF13424TPR_12593-619 aa

PF13432TPR_16593-608 aa

PF10952DUF2753593-620 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G065120	`PF13431`	TPR_17	294	309	0.028	15.4
TkA08G065120	`PF25575`	TPR_BSK1_C	586	668	2.2e-07	31.5
TkA08G065120	`PF29407`	CFAP70_TPR_C	588	620	0.00048	20.4
TkA08G065120	`PF00515`	TPR_1	589	617	1.9e-24	85.1
TkA08G065120	`PF07719`	TPR_2	589	617	5e-19	67.5
TkA08G065120	`PF13424`	TPR_12	593	619	2.2e-08	34.9
TkA08G065120	`PF13432`	TPR_16	593	608	0.0013	19.9
TkA08G065120	`PF10952`	DUF2753	593	620	0.013	16.3
TkA08G065120	`PF13181`	TPR_8	594	619	0.00013	22.6
TkA08G065120	`PF13414`	TPR_11	595	617	3.8e-05	24.0
TkA08G065120	`PF01535`	PPR	600	612	0.3	12.1
TkA08G065120	`PF00515`	TPR_1	636	667	1.9e-24	85.1
TkA08G065120	`PF07719`	TPR_2	636	666	5e-19	67.5
TkA08G065120	`PF13424`	TPR_12	637	661	2.2e-08	34.9
TkA08G065120	`PF13181`	TPR_8	637	666	0.00013	22.6
TkA08G065120	`PF14559`	TPR_19	645	688	6e-05	24.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card