TkA08G065080 | RubberDandelionOmics

Gene overview

TkA08G065080

Reference: TK1151 Chr: Chr08 Coordinates: 16607926-16610139 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1586 bp · TkA08G065080|TK1151|cDNA

CTTGCAACTCGCGTTTCCCTCTTAACAACAATTATCCAAATAAAAAAACCCTTTCAGGTTCGATTACAACCAAAAATGGCGGCTGAAACTGCAGCTGCTTCACATTTCCACTATCATTGCGGTTGGAGTCGGAGGAGATGCACCGCCGGATTCAAAACCCGACGCCGCCTGCCATTTCCACCGGCAGCTTCTTCTCAACCCATGGATATTCACACCAGCAATTCCTACAAAGAACTCGGTATGTTCTCGTTAAGAAAGAA...

CDS

Download CDS FASTA

651 bp · TkA08G065080|TK1151|CDS

ATGGCGGCTGAAACTGCAGCTGCTTCACATTTCCACTATCATTGCGGTTGGAGTCGGAGGAGATGCACCGCCGGATTCAAAACCCGACGCCGCCTGCCATTTCCACCGGCAGCTTCTTCTCAACCCATGGATATTCACACCAGCAATTCCTACAAAGAACTCGGTATGTTCTCGTTAAGAAAGAAGATAGAAGATTCCGTTAATCGAGCGGAAATTTTAGGTCTAACCGCATTGGAATTCGAAGAAACGCGACGAATCAA...

Protein

Download Protein FASTA

216 aa · TkA08G065080|TK1151|PROTEIN

MAAETAAASHFHYHCGWSRRRCTAGFKTRRRLPFPPAASSQPMDIHTSNSYKELGMFSLRKKIEDSVNRAEILGLTALEFEETRRIKQEEMIREYDLWDDLSKSSDILIKLADSAKVVDALKDLTYKVEEAKLITELAEMDIINYSLLKQAYTTSVDVSKFLDKYEMSKLLKGKYEFEGACVIIEAGSEGIRSEIWAEQLVGMYMKWAKKQGLKEG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G065080`
TK1151 ID	TkA08G065080
OH-1004 ID	LXL04_018495
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.074 / OH-1004 51.691 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G065080

Location Chr08:16607926-16610139 (+)

Description Similar to PRFB3: Peptide chain release factor PrfB3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57190`	Involved in the light- and stress-dependent regulation of stability of 3' processed petB transcripts, thus regulating cytochrome b6 accumulation, a rate-limiting step in photosynthetic electron transport.	Recruitment of a ribosomal release factor for light- and stress-dependent regulation of petB transcript stability in Arabidopsis chloroplasts.2011 · DOI: 10.1105/tpc.111.085324
`At5g36170`	Directs the termination of translation in response to the peptide chain termination codon UGA.	A peptide chain release factor 2 affects the stability of UGA-containing transcripts in Arabidopsis chloroplasts.2002 · DOI: 10.1105/tpc.006809

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018495 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006396 RNA processing Biological Process

GO:0006415 translational termination Biological Process

GO:0009657 plastid organization Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0043488 regulation of mRNA stability Biological Process

GO:0075523 viral translational frameshifting Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003730 mRNA 3'-UTR binding Molecular Function

GO:0003747 translation release factor activity Molecular Function

GO:0016149 translation release factor activity, codon specific Molecular Function

KEGG gene cross-reference

ath:AT3G57190

ath:AT5G36170

cyp:PCC8801_3422

syn:sll1865

syw:SYNW2311

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.965

Rank 1 · TkA08G065080 · TK1151

Mitochondrion0.038

Rank 2 · TkA08G065080 · TK1151

Nucleus0.032

Rank 3 · TkA08G065080 · TK1151

Cytoplasm0.027

Rank 4 · TkA08G065080 · TK1151

Peroxisome0.014

Rank 5 · TkA08G065080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03462PCRF87-214 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G065080	`PF03462`	PCRF	87	214	2.3e-10	41.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J264`	Arabidopsis thaliana	sp\|F4J264\|PRFB3_ARATH Peptide chain release factor PrfB3, chloroplastic	56.100%	Swiss-Prot	High
`Q9LVY0`	Arabidopsis thaliana	sp\|Q9LVY0\|PRFB1_ARATH Peptide chain release factor PrfB1, chloroplastic	33.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card