TkA08G064750 | RubberDandelionOmics

Gene overview

TkA08G064750

Reference: TK1151 Chr: Chr08 Coordinates: 16512985-16516645 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2601 bp · TkA08G064750|TK1151|cDNA

TAGGAAATAAGTTATTTTCCATTTTGATTTTTGAAGATATCACGTATTAAATTTAAGAAAAGGAGGCAACTTTGAAAAAAGCATTCGCATAAAGTCCTCGGCAAGTCTTTCAACCGACGACAGAGGGTGAAGGTGAACAGTCGAACGCCTTTTTGGGAATACAATCGATTGGGTTTTATAATTCCATCGGAGTTCAAGCTCACTCCAAATCCCACTTGAACCCTAAATCGTAACATACTGTAACTGCAATGGCTAGAGTA...

CDS

Download CDS FASTA

2145 bp · TkA08G064750|TK1151|CDS

ATGGCTAGAGTACATCCGGGGAATCTGAATTCCCGAGTTCCCGATCATCAAACAATTTTTGATCACGTTACCGAACATCTTCGTAATCAGGATTTTGAGACTAGAACTTGCGATGCAGCAAATCCTCGTGGCGGTGGAGGTGGCGGTGGTCGTGGTCGCGGTCGTGGTCGTGGTGGTGGAGTCAGGACCTGTTTTGGCTGCGGTGAACTCGGCCACATTATTCGCGATTGTCCGGCGACTGCCTCTTTTCCACGTAGTAA...

Protein

Download Protein FASTA

714 aa · TkA08G064750|TK1151|PROTEIN

MARVHPGNLNSRVPDHQTIFDHVTEHLRNQDFETRTCDAANPRGGGGGGGRGRGRGRGGGVRTCFGCGELGHIIRDCPATASFPRSNTRRGNQAFGNDPSNSDAIESTSGTSKYTLKPLNAFTPVDITPLLSKIRDKEQELKLSKEQNADLNMRLNKTTKELTSVQTKNEEMVLNMNTLKEDLEKIRKELSSAREKETVVIQMYSVMKNKFEELEDANEAADTKIEKLKSETEQWRKAAKAIAVVFNGGEVISSKTPELE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G064750`
TK1151 ID	TkA08G064750
OH-1004 ID	LXL04_018500
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 80.225 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G064750`
Location	Chr08:16512985-16516645 (+)
Description	Similar to DNAJC7: DnaJ homolog subfamily C member 7
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018500` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:0042026 protein refolding Biological Process GO:1900034 regulation of cellular response to heat Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005856 cytoskeleton Cellular Component GO:0016020 membrane Cellular Component GO:0045335 phagocytic vesicle Cellular Component GO:0070062 extracellular exosome Cellular Component GO:0001671 ATPase activator activity Molecular Function
KEGG gene cross-reference	ddi:DDB_G0288639 hsa:7266 mmu:56354 pon:100173101 spo:2541066 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.560

Rank 1 · TkA08G064750 · TK1151

Nucleus0.357

Rank 2 · TkA08G064750 · TK1151

Mitochondrion0.069

Rank 3 · TkA08G064750 · TK1151

Cell membrane0.061

Rank 4 · TkA08G064750 · TK1151

Peroxisome0.048

Rank 5 · TkA08G064750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30379SLU7_N59-77 aa

PF00098zf-CCHC62-78 aa

PF13696zf-CCHC_264-78 aa

PF29811YosV127-189 aa

PF24161CCDC39131-238 aa

PF06818Fez1131-246 aa

PF06785UPF0242133-230 aa

PF10473CENP-F_leu_zip133-240 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G064750	`PF30379`	SLU7_N	59	77	0.66	10.2
TkA08G064750	`PF00098`	zf-CCHC	62	78	2.7e-05	24.7
TkA08G064750	`PF13696`	zf-CCHC_2	64	78	0.42	11.2
TkA08G064750	`PF29811`	YosV	127	189	5.1	7.8
TkA08G064750	`PF24161`	CCDC39	131	238	0.00097	17.8
TkA08G064750	`PF06818`	Fez1	131	246	0.0072	17.5
TkA08G064750	`PF06785`	UPF0242	133	230	2.0	9.1
TkA08G064750	`PF10473`	CENP-F_leu_zip	133	240	2.1	9.1
TkA08G064750	`PF02090`	SPAM	134	237	0.39	11.3
TkA08G064750	`PF10241`	KxDL	138	192	0.21	12.6
TkA08G064750	`PF01496`	V_ATPase_I	141	295	0.065	11.9
TkA08G064750	`PF15035`	Rootletin	145	238	5.1	7.8
TkA08G064750	`PF24245`	INO80F	146	161	0.11	13.3
TkA08G064750	`PF03961`	FapA	147	240	5.5	7.2
TkA08G064750	`PF19111`	DUF5798	153	195	0.16	12.9
TkA08G064750	`PF24245`	INO80F	163	189	0.11	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card