TkA08G064700 | RubberDandelionOmics

Gene overview

TkA08G064700

Reference: TK1151 Chr: Chr08 Coordinates: 16499639-16500809 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1088 bp · TkA08G064700|TK1151|cDNA

ATGGGAAAGAAAAGATCGTGGTTGGGTTTCTTGAAGAGATTATTGATTTGCAACTCCCAATCGATCAAAGTGACCGATGGTAAGAAGGATCTGCAGGGAACAAAGAGACGGAAATGGTGCTTTGGGCTGCTGACGACGAGCCGCCGCCATTACCATGCAGTGGAAGCTCCGGCGGCGAAATTGAAGGAGGAGCAGAAACAGCACACGATGGCGCTTGCCGCAGCTATGACAGCTGCAGCTGAAGCAGCGGTGGCAGCTGC...

CDS

Download CDS FASTA

831 bp · TkA08G064700|TK1151|CDS

ATGGGAAAGAAAAGATCGTGGTTGGGTTTCTTGAAGAGATTATTGATTTGCAACTCCCAATCGATCAAAGTGACCGATGGTAAGAAGGATCTGCAGGGAACAAAGAGACGGAAATGGTGCTTTGGGCTGCTGACGACGAGCCGCCGCCATTACCATGCAGTGGAAGCTCCGGCGGCGAAATTGAAGGAGGAGCAGAAACAGCACACGATGGCGCTTGCCGCAGCTATGACAGCTGCAGCTGAAGCAGCGGTGGCAGCTGC...

Protein

Download Protein FASTA

276 aa · TkA08G064700|TK1151|PROTEIN

MGKKRSWLGFLKRLLICNSQSIKVTDGKKDLQGTKRRKWCFGLLTTSRRHYHAVEAPAAKLKEEQKQHTMALAAAMTAAAEAAVAAANAAAVLARLVRSPHRRTRYEAAIRIQSFYRSHLAWKALIGLRGVVKLQAVIRGEIVRRKLLNRLKNTQRSKLHRIRIPTTFDQISVICKDKQDLLRPIMSRRNDNVLEINPTRSNQMCETTQKKLRFGDRHHTDQEHQSPSFRSRMSCSYTKRHYHVSPNRSDETSLPDSPVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G064700`
TK1151 ID	TkA08G064700
OH-1004 ID	LXL04_018498
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.700
Protein coverage (%)	TK1151 94.203 / OH-1004 80.745 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G064700

Location Chr08:16499639-16500809 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13460`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018498 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010091 trichome branching Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT3G16490

ath:AT3G52290

ath:AT4G14750

ath:AT5G03960

ath:AT5G13460

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.384

Rank 1 · TkA08G064700 · TK1151

Cell membrane0.368

Rank 2 · TkA08G064700 · TK1151

Cytoplasm0.359

Rank 3 · TkA08G064700 · TK1151

Endoplasmic reticulum0.058

Rank 4 · TkA08G064700 · TK1151

Plastid0.047

Rank 5 · TkA08G064700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00612IQ6-13 aa

PF00612IQ48-52 aa

PF09534Trp_oprn_chp53-125 aa

PF00612IQ107-121 aa

PF00612IQ129-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G064700	`PF00612`	IQ	6	13	3.5e-05	23.9
TkA08G064700	`PF00612`	IQ	48	52	3.5e-05	23.9
TkA08G064700	`PF09534`	Trp_oprn_chp	53	125	0.033	14.8
TkA08G064700	`PF00612`	IQ	107	121	3.5e-05	23.9
TkA08G064700	`PF00612`	IQ	129	147	3.5e-05	23.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYR0`	Arabidopsis thaliana	sp\|Q9LYR0\|IQD11_ARATH Protein IQ-DOMAIN 11	30.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card