TkA08G063130 | RubberDandelionOmics

Gene overview

TkA08G063130

Reference: TK1151 Chr: Chr08 Coordinates: 16143849-16145372 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

879 bp · TkA08G063130|TK1151|cDNA

ATGATAGGATGTAAACCTGTAAATACTCTTCTTGATTTGTGTACTGTTGTTAGTAATAAAGGGGTTGACAGAAATGATAAACTGTTAAATGATTTTACTGGGTATCAAAAGTTAATAGGAAAACTTATTTACTTGACTATAACAAGACCTGATATTTCATATGCTATTCAGCGTTTAAGCCAGTTCATGCATGCACCTAGACAGTCTCATATCAAAGTTGCTATGAGATTGTTAAGGTACTTAAAGCTAAATCCTGGTAA...

CDS

Download CDS FASTA

879 bp · TkA08G063130|TK1151|CDS

ATGATAGGATGTAAACCTGTAAATACTCTTCTTGATTTGTGTACTGTTGTTAGTAATAAAGGGGTTGACAGAAATGATAAACTGTTAAATGATTTTACTGGGTATCAAAAGTTAATAGGAAAACTTATTTACTTGACTATAACAAGACCTGATATTTCATATGCTATTCAGCGTTTAAGCCAGTTCATGCATGCACCTAGACAGTCTCATATCAAAGTTGCTATGAGATTGTTAAGGTACTTAAAGCTAAATCCTGGTAA...

Protein

Download Protein FASTA

292 aa · TkA08G063130|TK1151|PROTEIN

MIGCKPVNTLLDLCTVVSNKGVDRNDKLLNDFTGYQKLIGKLIYLTITRPDISYAIQRLSQFMHAPRQSHIKVAMRLLRYLKLNPGKGISIIKSDSMQLVGYVDADWAKCRSSRRSVTDNNSAIQLSLNPVFHERTKHIEIDVHFVWTELMHLDNRSGLRNWAVVSSDDAEEKWWAVAFGEGRFNRFSLGFPVQWKNKYFRVRLHLHNFHIHEINLNPMDLKLENKFIILASDGFWRYFSPQEAGDLVGKLPNEGIAKRL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G063130`
TK1151 ID	TkA08G063130
OH-1004 ID	LXL04_025227
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.500
Protein coverage (%)	TK1151 51.712 / OH-1004 19.778 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G063130

Location Chr08:16143849-16145372 (+)

Description Similar to RE1: Retrovirus-related Pol polyprotein from transposon RE1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q94HW2`	Retrovirus-related Pol polyprotein from transposon RE1.	No verified direct reference in this release
`At4g02960`	Retrovirus-related Pol polyprotein from transposon RE2.	No verified direct reference in this release
`UniProt: P92519`	Uncharacterized mitochondrial protein AtMg00810.	No verified direct reference in this release
`UniProt: P93290`	Uncharacterized mitochondrial protein AtMg00240.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0685600`	Probable protein phosphatase 2C 25.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025227 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.376

Rank 1 · TkA08G063130 · TK1151

Nucleus0.203

Rank 2 · TkA08G063130 · TK1151

Mitochondrion0.155

Rank 3 · TkA08G063130 · TK1151

Peroxisome0.111

Rank 4 · TkA08G063130 · TK1151

Endoplasmic reticulum0.087

Rank 5 · TkA08G063130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481PP2C220-268 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G063130	`PF00481`	PP2C	220	268	1.1e-05	25.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94HW2`	Arabidopsis thaliana	sp\|Q94HW2\|POLR1_ARATH Retrovirus-related Pol polyprotein from transposon RE1	40.500%	Swiss-Prot	Low
`Q9ZT94`	Arabidopsis thaliana	sp\|Q9ZT94\|POLR2_ARATH Retrovirus-related Pol polyprotein from transposon RE2	38.200%	Swiss-Prot	Low
`P92519`	Arabidopsis thaliana	sp\|P92519\|M810_ARATH Uncharacterized mitochondrial protein AtMg00810	38.000%	Swiss-Prot	Low
`P93290`	Arabidopsis thaliana	sp\|P93290\|M240_ARATH Uncharacterized mitochondrial protein AtMg00240	41.700%	Swiss-Prot	Low
`Q6ZHC8`	Oryza sativa subsp. japonica	sp\|Q6ZHC8\|P2C25_ORYSJ Probable protein phosphatase 2C 25	52.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card