Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1577 bp · TkA08G059890|TK1151|cDNA
CCGACACCTTGCTCTATAAATTCAAAGCTACATCATTCTCCTACTATCATACGCCAACCTTAACAATGGCTTCACAAGGATACGTCACCTTTCTCACTTTTCTCCTCATCCCTATTCTCTTGATCTTTGTCTCATGGTACACTTGCAGTACTTCCCATGAATATTCACGCTTCTGTAGACCATATATGAACACCATTAAAGATTTCATCTTTAAAGATTCATACGATTTTGCTGATTTACCTCTCGTTTCAACTAAGATA...
612 bp · TkA08G059890|TK1151|CDS
ATGGCTTCACAAGGATACGTCACCTTTCTCACTTTTCTCCTCATCCCTATTCTCTTGATCTTTGTCTCATGGTACACTTGCAGTACTTCCCATGAATATTCACGCTTCTGTAGACCATATATGAACACCATTAAAGATTTCATCTTTAAAGATTCATACGATTTTGCTGATTTACCTCTCGTTTCAACTAAGATATTTGATGTCGATTCTTATGGTGCTAAAGGTGATGGCAAAAAAGATGATACGAAGGCATTCCAGAA...
Protein
Download Protein FASTA203 aa · TkA08G059890|TK1151|PROTEIN
MASQGYVTFLTFLLIPILLIFVSWYTCSTSHEYSRFCRPYMNTIKDFIFKDSYDFADLPLVSTKIFDVDSYGAKGDGKKDDTKAFQKAWKDACKSTTASVFSVAKNKKYLVSPIRFKGPCKSSLTMQVSGTILASKDRSKYKKDERHWLRVDGVENLLVQGGGVIDGNGDIWWSKLLQSRQDTTMQGCPNGFYALQVHNFDGE
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G059890 |
|---|---|
| TK1151 ID | TkA08G059890 |
| OH-1004 ID | LXL04_018434 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 91.700 |
| Protein coverage (%) | TK1151 94.581 / OH-1004 14.534Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G059890 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:15379355-15383034 (+) | |||||||||
| Description | Similar to Polygalacturonase | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0005975 carbohydrate metabolic process Biological Process GO:0009830 cell wall modification involved in abscission Biological Process GO:0009835 fruit ripening Biological Process GO:0009901 anther dehiscence Biological Process GO:0010047 fruit dehiscence Biological Process GO:0010227 floral organ abscission Biological Process GO:0045490 pectin catabolic process Biological Process GO:0005576 extracellular region Cellular Component GO:0005737 cytoplasm Cellular Component GO:0048046 apoplast Cellular Component GO:0004650 polygalacturonase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G41850 ath:AT3G57510 sly:544051 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12708Pect-lyase_RHGA_epim66-99 aaPF12218End_N_terminal73-93 aaPF00295Glyco_hydro_2893-199 aaPF12218End_N_terminal155-171 aaPF12708Pect-lyase_RHGA_epim178-178 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G059890 | PF12708 | Pect-lyase_RHGA_epim | 66 | 99 | 2.1e-06 | 28.4 |
| TkA08G059890 | PF12218 | End_N_terminal | 73 | 93 | 0.054 | 13.9 |
| TkA08G059890 | PF00295 | Glyco_hydro_28 | 93 | 199 | 3.7e-15 | 56.6 |
| TkA08G059890 | PF12218 | End_N_terminal | 155 | 171 | 0.054 | 13.9 |
| TkA08G059890 | PF12708 | Pect-lyase_RHGA_epim | 178 | 178 | 2.1e-06 | 28.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.