TkA08G058200 | RubberDandelionOmics

Gene overview

TkA08G058200

Reference: TK1151 Chr: Chr08 Coordinates: 14879336-14879719 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

384 bp · TkA08G058200|TK1151|cDNA

ATGAAGGAAACGGCGGCGAACATCGCCGCGTCAGCGCTGTCGGGGATGGAGAAAACAAAGGCGGTGTTAGAAGAGAAGGTTGAGAAGATCAGTACGAGTGATCCAATCGAAAAAGACATGGCAACGTTGAAGAAAGAAGACAGAATCAGGCTGGCTGAGATCCGGAAACGAGAGGCGTATACCCAGAACGCCGCCGCCGCTACCGGTGGTCCTAATAGTCCCACCTTCACCGCAGCTGGTCAAGTTCAACCCGAAAAGAA...

CDS

Download CDS FASTA

384 bp · TkA08G058200|TK1151|CDS

ATGAAGGAAACGGCGGCGAACATCGCCGCGTCAGCGCTGTCGGGGATGGAGAAAACAAAGGCGGTGTTAGAAGAGAAGGTTGAGAAGATCAGTACGAGTGATCCAATCGAAAAAGACATGGCAACGTTGAAGAAAGAAGACAGAATCAGGCTGGCTGAGATCCGGAAACGAGAGGCGTATACCCAGAACGCCGCCGCCGCTACCGGTGGTCCTAATAGTCCCACCTTCACCGCAGCTGGTCAAGTTCAACCCGAAAAGAA...

Protein

Download Protein FASTA

127 aa · TkA08G058200|TK1151|PROTEIN

MKETAANIAASALSGMEKTKAVLEEKVEKISTSDPIEKDMATLKKEDRIRLAEIRKREAYTQNAAAATGGPNSPTFTAAGQVQPEKNPFQKTTSDVKNTAKPAVQQGRGATVEKATPVVQSTNAMSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G058200`
TK1151 ID	TkA08G058200
OH-1004 ID	LXL04_018389
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 69.022 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G058200

Location Chr08:14879336-14879719 (+)

Description Similar to LEA46: Late embryogenesis abundant protein 46

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06760`	Involved dehydration tolerance.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018389 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0048316 seed development Biological Process

GO:0051260 protein homooligomerization Biological Process

GO:0005829 cytosol Cellular Component

GO:0004460 L-lactate dehydrogenase (cytochrome) activity Molecular Function

GO:0005034 osmosensor activity Molecular Function

GO:0005507 copper ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G06760

gmx:547828

han:110885558

sly:101253038

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.520

Rank 1 · TkA08G058200 · TK1151

Nucleus0.248

Rank 2 · TkA08G058200 · TK1151

Mitochondrion0.144

Rank 3 · TkA08G058200 · TK1151

Cell membrane0.138

Rank 4 · TkA08G058200 · TK1151

Extracellular0.052

Rank 5 · TkA08G058200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03760LEA_11-68 aa

PF17511Mobilization_B24-112 aa

PF03760LEA_190-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G058200	`PF03760`	LEA_1	1	68	7.6e-19	68.7
TkA08G058200	`PF17511`	Mobilization_B	24	112	0.19	12.8
TkA08G058200	`PF03760`	LEA_1	90	116	7.6e-19	68.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FG31`	Arabidopsis thaliana	sp\|Q9FG31\|LEA46_ARATH Late embryogenesis abundant protein 46	66.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card