TkA08G057880 | RubberDandelionOmics

Gene overview

TkA08G057880

Reference: TK1151 Chr: Chr08 Coordinates: 14791007-14800404 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1641 bp · TkA08G057880|TK1151|cDNA

ATAACCGGAGTGCAAAAGAGAAGCTATCTCTAGTCGTCTCTGTTATTAGGGTTTCAACCCACAAATTGTCAATTTTAAGAATCTAAATGTGTGTTATGAGAACCGACTTTTGGTTTCTTAACTCGGTAATTTTTTATAGATTTGTTATTTTAAGAAAACCTAATTCTTGAATTAGGGTTCTTCAAGTCGATACCGAATCCAGATAAAGCACAAAATCCTGAAGTTTTGTCGCATACCAGTCGCACTCTTAATCCACAGGT...

CDS

Download CDS FASTA

1131 bp · TkA08G057880|TK1151|CDS

ATGTTCAATCTCGTCGGAAGAAACTTTAGATTGTCTGGGTTCATAACAACATCTGTTCATAATAGACTATTCCCTCGCTCATCATCTTCGTCACCAGCTGCATCAGATAACTCCTTCGCAGCTTCATACCTCATTGACTCATGTGGGTTCCCTTCAGAAAAGGCGATTTCAGCTTCCAAACATTTAAAATTCAAAACCGCAGATCGAGCAGATTCGGTAATAGCGTTTTTCAAGAATCAGGGGTTCACAGAAACCCAAAT...

Protein

Download Protein FASTA

376 aa · TkA08G057880|TK1151|PROTEIN

MFNLVGRNFRLSGFITTSVHNRLFPRSSSSSPAASDNSFAASYLIDSCGFPSEKAISASKHLKFKTADRADSVIAFFKNQGFTETQIDHLVRKFPMSLNYHPEKNLLPKFEFLTSIGLSDSDIIKIFTSKPSFLSRSLKNHVEPTYNSLRDLLQSNDKTLVAIRRCAWILDWDFQTIVIPNMQFLRDVGVPGSKIFLLLTHMPTVFLTTTDHFKKVVEEVVKIGFDPLKTNFVLAVHAKKSMSKSTWEKKMETYEKWGWS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G057880`
TK1151 ID	TkA08G057880
OH-1004 ID	LXL04_018378
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 99.468 / OH-1004 46.809 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G057880`
Location	Chr08:14791007-14800404 (+)
Description	Similar to MTERF8: Transcription termination factor MTERF8, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018378` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006353 DNA-templated transcription termination Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006393 termination of mitochondrial transcription Biological Process GO:0006970 response to osmotic stress Biological Process GO:0009651 response to salt stress Biological Process GO:0009658 chloroplast organization Biological Process GO:0009737 response to abscisic acid Biological Process GO:0015979 photosynthesis Biological Process GO:0042793 plastid transcription Biological Process GO:0048598 embryonic morphogenesis Biological Process GO:0140899 plastid gene expression Biological Process GO:0005739 mitochondrion Cellular Component
KEGG gene cross-reference	ath:AT2G21710 ath:AT2G36000 ath:AT4G14605 ath:AT5G54180 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.728

Rank 1 · TkA08G057880 · TK1151

Plastid0.171

Rank 2 · TkA08G057880 · TK1151

Cytoplasm0.034

Rank 3 · TkA08G057880 · TK1151

Nucleus0.029

Rank 4 · TkA08G057880 · TK1151

Cell membrane0.007

Rank 5 · TkA08G057880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09288UBA_347-71 aa

PF04695Pex14_N72-91 aa

PF09288UBA_374-87 aa

PF02536mTERF75-226 aa

PF04695Pex14_N109-127 aa

PF09288UBA_3215-227 aa

PF02536mTERF242-350 aa

PF09288UBA_3252-268 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G057880	`PF09288`	UBA_3	47	71	0.071	13.7
TkA08G057880	`PF04695`	Pex14_N	72	91	0.087	13.2
TkA08G057880	`PF09288`	UBA_3	74	87	0.071	13.7
TkA08G057880	`PF02536`	mTERF	75	226	6.8e-36	124.5
TkA08G057880	`PF04695`	Pex14_N	109	127	0.087	13.2
TkA08G057880	`PF09288`	UBA_3	215	227	0.071	13.7
TkA08G057880	`PF02536`	mTERF	242	350	6.8e-36	124.5
TkA08G057880	`PF09288`	UBA_3	252	268	0.071	13.7
TkA08G057880	`PF09288`	UBA_3	290	298	0.071	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card