TkA08G057090 | RubberDandelionOmics

Gene overview

TkA08G057090

Reference: TK1151 Chr: Chr08 Coordinates: 14585516-14588590 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1169 bp · TkA08G057090|TK1151|cDNA

ATACAATTTGTAGCGAGGCTATTTGTATCACCATCTTCATGTACTATTAGTCTATACCCATAGATCTATCTTTGTATCACCATCTTCTAGCTTTAGCCTATACCCATAAATATATCTCCCTTTCATCATGGCTTCTCAAGTTCTTTCCATCTTACTCTTGTTTTTGACAACATGTGCCAATTATGTGAATGGGGGAGCAGGAGCACCACCACAATTCGGTTACTTGGGCCCCTACGGGCCACGAAAATGGGGAAAACTAA...

CDS

Download CDS FASTA

822 bp · TkA08G057090|TK1151|CDS

ATGGCTTCTCAAGTTCTTTCCATCTTACTCTTGTTTTTGACAACATGTGCCAATTATGTGAATGGGGGAGCAGGAGCACCACCACAATTCGGTTACTTGGGCCCCTACGGGCCACGAAAATGGGGAAAACTAAGCCCAACATATTCAGCCTGCTCAAATGGCAAGTTTCAGTCTCCTATCAACATCGTGAAGTCAAAATGCGTTCCTGGTCAACACCTGAAGCCATTAGACATCGAATATCATATTACAGCCAATGCTAC...

Protein

Download Protein FASTA

273 aa · TkA08G057090|TK1151|PROTEIN

MASQVLSILLLFLTTCANYVNGGAGAPPQFGYLGPYGPRKWGKLSPTYSACSNGKFQSPINIVKSKCVPGQHLKPLDIEYHITANATLVDNLFNVGMNYDGKAGMLRLDGKNYTLIQMHWHSPSEHELNGVRYAAELHLVHKSADGGVAVIAVLYHYGHPDPLLSKIQTKLEQLVKAAHNSTQKQAQVALGAITTKEIRKHSRKYYRYIGSFSTPPCTEGVIWYILGKVKSISKEQVQELKAPLIWECKSNSRPVQPMNG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G057090`
TK1151 ID	TkA08G057090
OH-1004 ID	LXL04_018357
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 94.792 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G057090

Location Chr08:14585516-14588590 (+)

Description Similar to ACA1: Alpha carbonic anhydrase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52720`	Reversible hydration of carbon dioxide.	No verified direct reference in this release
`At1g08080`	Reversible hydration of carbon dioxide.	No verified direct reference in this release
`At4g20990`	Reversible hydration of carbon dioxide.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018357 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000305 response to oxygen radical Biological Process

GO:0006730 one-carbon metabolic process Biological Process

GO:0006885 regulation of pH Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004089 carbonate dehydratase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016656 monodehydroascorbate reductase (NADH) activity Molecular Function

KEGG gene cross-reference

ath:AT1G08080

ath:AT3G52720

ath:AT4G20990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.482

Rank 1 · TkA08G057090 · TK1151

Lysosome / Vacuole0.174

Rank 2 · TkA08G057090 · TK1151

Cytoplasm0.139

Rank 3 · TkA08G057090 · TK1151

Endoplasmic reticulum0.109

Rank 4 · TkA08G057090 · TK1151

Cell membrane0.095

Rank 5 · TkA08G057090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00194Carb_anhydrase37-264 aa

PF16276NPM1-C163-186 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G057090	`PF00194`	Carb_anhydrase	37	264	1e-39	137.4
TkA08G057090	`PF16276`	NPM1-C	163	186	0.11	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04846`	Arabidopsis thaliana	sp\|O04846\|ATCA1_ARATH Alpha carbonic anhydrase 1, chloroplastic	50.200%	Swiss-Prot	High
`Q8L817`	Arabidopsis thaliana	sp\|Q8L817\|ATCA7_ARATH Alpha carbonic anhydrase 7	37.800%	Swiss-Prot	Medium
`F4JIK2`	Arabidopsis thaliana	sp\|F4JIK2\|ATCA4_ARATH Alpha carbonic anhydrase 4	41.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card