TkA08G055660 | RubberDandelionOmics

Gene overview

TkA08G055660

Reference: TK1151 Chr: Chr08 Coordinates: 14248520-14251714 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1507 bp · TkA08G055660|TK1151|cDNA

GGAGAAAAAGGGTAAAATAAGTGAAGGTTTGAACTGTGTGCCGATTTTGATAGACGGAAAAGACACGAGGCCGCCACACGCTGGCTGTCAAGAGCTCCGGCGCTTACTAAAACCACCGACCAACGCTCCCTACGCCTCCCGATCACACCTTCAAATTCAATCGTCAATCGCCGAACACCGTTTCTTCGACCCTACAATACGGCTGCGATGACTTTACTCGAAGAAGAGAGCTTGAAACTTACCGAAGTTCAAAAGCTAGA...

CDS

Download CDS FASTA

1056 bp · TkA08G055660|TK1151|CDS

ATGACTTTACTCGAAGAAGAGAGCTTGAAACTTACCGAAGTTCAAAAGCTAGAAGGTCATACTGATAGGGTATGGGGTCTAGCTTGGAATCCGGCTACCGGTGCTGACGGTGTACCTGCTATCCTCGCCTCTTGTAGTGGCGACAAGACTGTTCGAATCTGGCAACAACGTAGCCCTTCCTCTACATCCTTTGATTGCAAGGCAGTATTAGAAGACAGACATACTCGAACAGTTCGATCATGTTCCTGGTCACCATCCGG...

Protein

Download Protein FASTA

351 aa · TkA08G055660|TK1151|PROTEIN

MTLLEEESLKLTEVQKLEGHTDRVWGLAWNPATGADGVPAILASCSGDKTVRIWQQRSPSSTSFDCKAVLEDRHTRTVRSCSWSPSGKQLATASFDATTAIWEQNGTDFECVSTLEGHENEVKSVSWNASGSLLATCSRDKCVWIWEVLPGNEFDCVSVLQGHTQDVKMVQWHPTVDVLFSCSYDNTIKVWADDGDSDDWHCVQTLGESNSGHSSTVWALSFNSTGDKMVTCSDDLTIKVWDVDIVRLQSGDADASWRHV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G055660`
TK1151 ID	TkA08G055660
OH-1004 ID	LXL04_000474
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	83.100
Protein coverage (%)	TK1151 99.715 / OH-1004 99.432 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G055660

Location Chr08:14248520-14251714 (+)

Description Similar to CIA1: Protein CIA1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26060`	Essential component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000474 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0051604 protein maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0097361 cytosolic [4Fe-4S] assembly targeting complex Cellular Component

KEGG gene cross-reference

ath:AT2G26060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.587

Rank 1 · TkA08G055660 · TK1151

Nucleus0.548

Rank 2 · TkA08G055660 · TK1151

Cell membrane0.066

Rank 3 · TkA08G055660 · TK1151

Lysosome / Vacuole0.064

Rank 4 · TkA08G055660 · TK1151

Golgi apparatus0.057

Rank 5 · TkA08G055660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23775Beta-prop_RIG_2nd7-64 aa

PF23609Beta-prop_EIPR19-54 aa

PF24797Beta-prop_WDR35_TULP_N9-97 aa

PF25174Beta-prop_THOC310-62 aa

PF23770Beta-prop_RIG_1st10-31 aa

PF25175Beta-prop_WDR512-103 aa

PF23381Beta-prop_IFT122_1st12-107 aa

PF24817WD40_WDHD1_1st12-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G055660	`PF23775`	Beta-prop_RIG_2nd	7	64	3.3e-15	57.0
TkA08G055660	`PF23609`	Beta-prop_EIPR1	9	54	9.4e-14	52.2
TkA08G055660	`PF24797`	Beta-prop_WDR35_TULP_N	9	97	4.3e-13	49.8
TkA08G055660	`PF25174`	Beta-prop_THOC3	10	62	2e-52	178.6
TkA08G055660	`PF23770`	Beta-prop_RIG_1st	10	31	0.57	9.4
TkA08G055660	`PF25175`	Beta-prop_WDR5	12	103	3.3e-53	181.6
TkA08G055660	`PF23381`	Beta-prop_IFT122_1st	12	107	6.6e-51	174.0
TkA08G055660	`PF24817`	WD40_WDHD1_1st	12	149	6.7e-27	95.1
TkA08G055660	`PF24105`	Beta-prop_CAF1B_HIR1	12	32	3.9e-25	89.3
TkA08G055660	`PF00400`	WD40	13	54	1e-56	187.6
TkA08G055660	`PF25173`	Beta-prop_WDR3_1st	13	55	1.2e-40	139.9
TkA08G055660	`PF24807`	WD40_CDC20-Fz	13	85	7.2e-31	108.3
TkA08G055660	`PF23409`	Beta-prop_EML	13	147	2.9e-11	44.1
TkA08G055660	`PF24814`	WD40_Prp19	14	60	5.9e-40	137.8
TkA08G055660	`PF25172`	Beta-prop_WDR3_2nd	14	242	1.8e-29	103.7
TkA08G055660	`PF25047`	Beta-prop_TEP1_2nd	14	103	1e-22	81.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80990`	Arabidopsis thaliana	sp\|O80990\|CIA1_ARATH Protein CIA1	74.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card