TkA08G053800 | RubberDandelionOmics

Gene overview

TkA08G053800

Reference: TK1151 Chr: Chr08 Coordinates: 13766956-13768107 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

972 bp · TkA08G053800|TK1151|cDNA

GGAAGATGATGCTTTAGGGTAAAAAGATGGCGGGAACTCTTGGCGCCATACCCCGTACTCTCACTTTAGTGGGCTATAGCATCCCTTATAAACCCTACCCCAATCGCCATTACCGTTTTCCTCCATTTTGTTTCTCTCTCGTCAACTTCTCATCCAAACCACCCTTCCGTCGGCTAGTTTCAGTCATGTCCAACAAAAACGGCAACCCTGAAATCGAAGAACCGGCCCCAAAGGTTCAGAAAATCGACGATCTCAACGGA...

CDS

Download CDS FASTA

675 bp · TkA08G053800|TK1151|CDS

ATGGCGGGAACTCTTGGCGCCATACCCCGTACTCTCACTTTAGTGGGCTATAGCATCCCTTATAAACCCTACCCCAATCGCCATTACCGTTTTCCTCCATTTTGTTTCTCTCTCGTCAACTTCTCATCCAAACCACCCTTCCGTCGGCTAGTTTCAGTCATGTCCAACAAAAACGGCAACCCTGAAATCGAAGAACCGGCCCCAAAGGTTCAGAAAATCGACGATCTCAACGGAAACTCCGGCCACCAATCGCCTCTTTT...

Protein

Download Protein FASTA

224 aa · TkA08G053800|TK1151|PROTEIN

MAGTLGAIPRTLTLVGYSIPYKPYPNRHYRFPPFCFSLVNFSSKPPFRRLVSVMSNKNGNPEIEEPAPKVQKIDDLNGNSGHQSPLFKVKKLSEKAILPARGSPLAAGYDLSSAIETKVPARGKALVATDLSIAVPEGTYARIAPRSGLTWKHSVDVGAGVIDADYRGPVGVILFNHSDTDFEVKAGDRIAQLIIEKIITPEVVEVDDLDSTVRGAAGFGSTGV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G053800`
TK1151 ID	TkA08G053800
OH-1004 ID	LXL04_017731
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	98.200
Protein coverage (%)	TK1151 76.339 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G053800

Location Chr08:13766956-13768107 (+)

Description Similar to DUT: Deoxyuridine 5'-triphosphate nucleotidohydrolase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46940`	This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP, preventing uracil incorporation into DNA.	The SOS screen in Arabidopsis: a search for functions involved in DNA metabolism.2010 · DOI: 10.1016/j.dnarep.2010.02.009

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0669100`	This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP, preventing uracil incorporation into DNA.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017731 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006226 dUMP biosynthetic process Biological Process

GO:0006281 DNA repair Biological Process

GO:0009213 pyrimidine deoxyribonucleoside triphosphate catabolic process Biological Process

GO:0035863 dITP catabolic process Biological Process

GO:0046081 dUTP catabolic process Biological Process

GO:0046104 thymidine metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004170 dUTP diphosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT3G46940

ddi:DDB_G0293374

dosa:Os03g0669100

sly:544274

spo:2543669

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.946

Rank 1 · TkA08G053800 · TK1151

Mitochondrion0.089

Rank 2 · TkA08G053800 · TK1151

Cytoplasm0.052

Rank 3 · TkA08G053800 · TK1151

Nucleus0.028

Rank 4 · TkA08G053800 · TK1151

Peroxisome0.023

Rank 5 · TkA08G053800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00692dUTPase95-223 aa

PF22769DCD125-197 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G053800	`PF00692`	dUTPase	95	223	9.7e-45	152.2
TkA08G053800	`PF22769`	DCD	125	197	4.9e-09	37.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STG6`	Arabidopsis thaliana	sp\|Q9STG6\|DUT_ARATH Deoxyuridine 5'-triphosphate nucleotidohydrolase	80.500%	Swiss-Prot	High
`Q10FF9`	Oryza sativa subsp. japonica	sp\|Q10FF9\|DUT_ORYSJ Deoxyuridine 5'-triphosphate nucleotidohydrolase	73.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card