TkA08G048080 | RubberDandelionOmics

Gene overview

TkA08G048080

Reference: TK1151 Chr: Chr08 Coordinates: 12216009-12219177 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2839 bp · TkA08G048080|TK1151|cDNA

GTACAGAGTGCTTCCCATTTCCAAAAGTTTCAACTCCTCGTAGAAAAATCTCCCTTTACTCTCTCTTCCTGCCGTCTACTAAACGCAACTGTCTCAAGGTACACCTTACATTTGCTCTCTCTATTCGGTGAATTTAACGCTTGATTTGATCACGTATTGATTTCTTCTCGTTTGAATCTTGCTCTGGTTTGAGATGATTAGCTGAAACCAACGGAATCGATCAAATGAAATTCAGTTTTTAATATTCTCTGCTTACGGAA...

CDS

Download CDS FASTA

2145 bp · TkA08G048080|TK1151|CDS

ATGGTTATGGAGTCACGTTTTAACGAAAACCTGGATTACAACAACGCTTTCTTATTAGACGACGAGACCACCTTACCGACATTCGATCAATTTCCAGTTCATAACACCGGATACAGATTCAGAGAAGAACCCCTAGATCTCAGCTTCTTAGATCCGCCTGTATCCAACAATGATCCCGGTACTGTAAATTCTTTTCCAGATGCTACCTCACAAGTGGATTCTCCCGATGATTTCTCAGATTGTGTTTCCAAGTACCTCAA...

Protein

Download Protein FASTA

714 aa · TkA08G048080|TK1151|PROTEIN

MVMESRFNENLDYNNAFLLDDETTLPTFDQFPVHNTGYRFREEPLDLSFLDPPVSNNDPGTVNSFPDATSQVDSPDDFSDCVSKYLNQILMEENMENTQGTFHDPLALQEFEKSFYEDVREKHPNPHQPPPSVNLSLNVDSPDEISCRSSGEYSARSSTSGGDSFETKSPFTQTYLLDSPTFRPTINVTDSVQMVPNIFTNQESILQYKRGKEEASKFLPLTKPLIIDLDKYNLPSKNPPEVVVKVENIETCNSNSSDGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G048080`
TK1151 ID	TkA08G048080
OH-1004 ID	LXL04_036427
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	53.700
Protein coverage (%)	TK1151 99.300 / OH-1004 93.734 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G048080

Location Chr08:12216009-12219177 (+)

Description Similar to SCL14: Scarecrow-like protein 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07530`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At2g29060`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At2g29065`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At1g07520`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At2g37650`	Probable transcription factor involved in plant development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036427 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0080183 response to photooxidative stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G07520

ath:AT1G07530

ath:AT2G29060

ath:AT2G29065

ath:AT2G37650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.829

Rank 1 · TkA08G048080 · TK1151

Cytoplasm0.257

Rank 2 · TkA08G048080 · TK1151

Cell membrane0.030

Rank 3 · TkA08G048080 · TK1151

Endoplasmic reticulum0.025

Rank 4 · TkA08G048080 · TK1151

Plastid0.020

Rank 5 · TkA08G048080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29835SOV1_N247-296 aa

PF25829DUF7953277-309 aa

PF03514GRAS343-711 aa

PF16699CSTF1_dimer359-392 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G048080	`PF29835`	SOV1_N	247	296	0.014	16.3
TkA08G048080	`PF25829`	DUF7953	277	309	0.054	14.2
TkA08G048080	`PF03514`	GRAS	343	711	7e-112	374.8
TkA08G048080	`PF16699`	CSTF1_dimer	359	392	0.11	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XE58`	Arabidopsis thaliana	sp\|Q9XE58\|SCL14_ARATH Scarecrow-like protein 14	46.000%	Swiss-Prot	Medium
`P0C883`	Arabidopsis thaliana	sp\|P0C883\|SCL33_ARATH Scarecrow-like protein 33	42.800%	Swiss-Prot	Medium
`P0C884`	Arabidopsis thaliana	sp\|P0C884\|SCL34_ARATH Scarecrow-like protein 34	43.700%	Swiss-Prot	Medium
`Q3EDH0`	Arabidopsis thaliana	sp\|Q3EDH0\|SCL31_ARATH Scarecrow-like protein 31	43.300%	Swiss-Prot	Medium
`O80933`	Arabidopsis thaliana	sp\|O80933\|SCL9_ARATH Scarecrow-like protein 9	39.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card