TkA08G047250 | RubberDandelionOmics

Gene overview

TkA08G047250

Reference: TK1151 Chr: Chr08 Coordinates: 12016856-12017251 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

396 bp · TkA08G047250|TK1151|cDNA

ATGAACACCATTGTTGGCGGTTACTTTATACCAAAAGGTAGTCATGTGTTGCTTGCTCGAATTGGGCTGGGAAGGAATCCTGATGTGTGGGCGGATCCATTGAGGTTTAATCCTGATCGTCATCTTGAAGGGGAAGATAAGCAAGTGGTTCTTACAGATGATGAATTGAAAATGATATCATTTAGCACCGGGAAACATGGTTGTCCTGCGGCGGTGTTGGGCTCCTCTATGACTACATTGATGTTAGCCAGAATGCTTCA...

CDS

Download CDS FASTA

396 bp · TkA08G047250|TK1151|CDS

ATGAACACCATTGTTGGCGGTTACTTTATACCAAAAGGTAGTCATGTGTTGCTTGCTCGAATTGGGCTGGGAAGGAATCCTGATGTGTGGGCGGATCCATTGAGGTTTAATCCTGATCGTCATCTTGAAGGGGAAGATAAGCAAGTGGTTCTTACAGATGATGAATTGAAAATGATATCATTTAGCACCGGGAAACATGGTTGTCCTGCGGCGGTGTTGGGCTCCTCTATGACTACATTGATGTTAGCCAGAATGCTTCA...

Protein

Download Protein FASTA

131 aa · TkA08G047250|TK1151|PROTEIN

MNTIVGGYFIPKGSHVLLARIGLGRNPDVWADPLRFNPDRHLEGEDKQVVLTDDELKMISFSTGKHGCPAAVLGSSMTTLMLARMLQGYTWEVPCNDRPIKLVEKHDGLSLAKPLVLIAKPRLPQHVYPTN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G047250`
TK1151 ID	TkA08G047250
OH-1004 ID	LXL04_017828
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.100
Protein coverage (%)	TK1151 100.000 / OH-1004 33.165 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G047250

Location Chr08:12016856-12017251 (+)

Description Similar to CYP79D1: Valine N-monooxygenase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39950`	Converts tryptophan to indole-3-acetaldoxime, a precursor for tryptophan-derived glucosinolates and indole-3-acetic acid (IAA).	Arabidopsis cytochrome P450s that catalyze the first step of tryptophan-dependent indole-3-acetic acid biosynthesis.2000 · DOI: 10.1073/pnas.040569997 Cytochrome P450 CYP79B2 from Arabidopsis catalyzes the conversion of tryptophan to indole-3-acetaldoxime, a precursor of indole glucosinolates and indole-3-acetic acid.2000 · DOI: 10.1074/jbc.m001667200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017828 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010132 dhurrin biosynthetic process Biological Process

GO:0019756 cyanogenic glycoside biosynthetic process Biological Process

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0020037 heme binding Molecular Function

GO:0050370 tyrosine N-monooxygenase activity Molecular Function

GO:0102001 isoleucine N-monooxygenase (oxime forming) activity Molecular Function

GO:0102002 valine N-monooxygenase (oxime forming) activity Molecular Function

GO:0102684 L-phenylalanine N-monooxygenase activity Molecular Function

KEGG gene cross-reference

ag:AAF27289

ag:AAF27290

ag:AAT11920

ag:AAV97888

ag:AAV97889

sbi:8061413

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.207

Rank 1 · TkA08G047250 · TK1151

Plastid0.157

Rank 2 · TkA08G047250 · TK1151

Mitochondrion0.134

Rank 3 · TkA08G047250 · TK1151

Peroxisome0.095

Rank 4 · TkA08G047250 · TK1151

Cytoplasm0.043

Rank 5 · TkA08G047250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p4504-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G047250	`PF00067`	p450	4	114	1.4e-20	74.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81346`	Arabidopsis thaliana	sp\|O81346\|C79B2_ARATH Tryptophan N-monooxygenase 1	58.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card