TkA08G045340 | RubberDandelionOmics

Gene overview

TkA08G045340

Reference: TK1151 Chr: Chr08 Coordinates: 11572338-11574757 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1923 bp · TkA08G045340|TK1151|cDNA

GTCGCCGTTCCTTGTCGTCTCCGCCGTCGTCGCCGTTCCTTGTCATCTCCCCCAAAGTAGGTTCCCGTTGCTCCGACTGTAAATTAATTTCTCCAGTCAAATTGCCGCATTTTCCTCCGCCATTACTCTTCTGCAACTCTCGCCAGACTTCATCAACAGTCTTCTGGCTAAGTGTTCTTGATCCCTGTCTTTGTATATTCGCGTTATTCGGGATTCCGAAATTTGAAGTGGATGCCATTGATTGAGTTTCTTCGGCAGTC...

CDS

Download CDS FASTA

897 bp · TkA08G045340|TK1151|CDS

ATGGTGGTGGATAACCTCGGAAACGCACCTGCTCAAAAACCTCGATGGGGAGAACTCGAAGAAGAAGATGATGGTGGAGACTATGACTATTTGCTGCCGCCAAAACAGGTTATCGGACCTGACGAACACGGTATAAAAAAGGTTATCGAGTATAAGTTCAACGATGAAGGTAATCGGGTGAAGATAACCACAACCACACGCGTCCGTAAGCTCGCCAACGCTCGGCTCAGCAAACGCGCCGTGGAGAGGCGTTCATGGCC...

Protein

Download Protein FASTA

298 aa · TkA08G045340|TK1151|PROTEIN

MVVDNLGNAPAQKPRWGELEEEDDGGDYDYLLPPKQVIGPDEHGIKKVIEYKFNDEGNRVKITTTTRVRKLANARLSKRAVERRSWPKFGDAVQEDVGARLTMVSTEEIIFERPRAPGTKAEDSNASGDPLAQMSKGGAVLMVCRTCGKKGDHWTSKCPYKDLAQPTESFTENPNPTDSSASGPPGATKGAYVPPTMRPGAVRPTAGADMRRRNDENSVRVNNLSEDTREPDLLELFRPFGNVSRVYVAMDQKTGMSRGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G045340`
TK1151 ID	TkA08G045340
OH-1004 ID	LXL04_017849
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 95.973 / OH-1004 96.949 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G045340`
Location	Chr08:11572338-11574757 (+)
Description	Similar to eif3g: Eukaryotic translation initiation factor 3 subunit G
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017849` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001732 formation of cytoplasmic translation initiation complex Biological Process GO:0006413 translational initiation Biological Process GO:0005852 eukaryotic translation initiation factor 3 complex Cellular Component GO:0016282 eukaryotic 43S preinitiation complex Cellular Component GO:0033290 eukaryotic 48S preinitiation complex Cellular Component GO:0003723 RNA binding Molecular Function GO:0003743 translation initiation factor activity Molecular Function
KEGG gene cross-reference	dre:393974 nve:5507244 xla:446311 xla:447749 xtr:549503 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.610

Rank 1 · TkA08G045340 · TK1151

Cytoplasm0.504

Rank 2 · TkA08G045340 · TK1151

Cell membrane0.048

Rank 3 · TkA08G045340 · TK1151

Endoplasmic reticulum0.038

Rank 4 · TkA08G045340 · TK1151

Golgi apparatus0.029

Rank 5 · TkA08G045340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12353eIF3g36-163 aa

PF26602HVO_2718_N129-152 aa

PF13696zf-CCHC_2143-159 aa

PF00076RRM_1219-285 aa

PF29396F07F6_N262-294 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G045340	`PF12353`	eIF3g	36	163	3.5e-34	118.6
TkA08G045340	`PF26602`	HVO_2718_N	129	152	0.079	13.2
TkA08G045340	`PF13696`	zf-CCHC_2	143	159	0.0024	18.4
TkA08G045340	`PF00076`	RRM_1	219	285	1.2e-17	64.2
TkA08G045340	`PF29396`	F07F6_N	262	294	0.067	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card