TkA08G044740 | RubberDandelionOmics

Gene overview

TkA08G044740

Reference: TK1151 Chr: Chr08 Coordinates: 11417753-11421613 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2746 bp · TkA08G044740|TK1151|cDNA

TATACATCATGTTTGAACCCAAATTTGTTTCAATCATAATCACAGATCTAGAAGCGTTGAAGTTATATGCATCAAGTGTGGACTCCAAATTTAATGGCGTCGCAGACTTCCACCGACGACTATAATAACGCCCCAGTCTTCACTTCTCCGCCACTCTATGTATAAAATTGCATTCATATCCGCATTTCCTCCATTTCTCCCAGCCTCTCTCTCTCCTTCAATCACGCACGGTTGGTTAATGGAGTAGCCACTGAATCTGT...

CDS

Download CDS FASTA

2268 bp · TkA08G044740|TK1151|CDS

ATGGAGTTCTTTCAGGCTCTGATCCAGAAACGACGCTCAATTGCATGGATTTGGGTGTTATTACTAGTATTTCTACTAAACGGGAAACCAACAATCTCAGCTTCAAATTACTTAGTTGGACTTGGAAGCTATGACATCACAGGTCCCGCAGCTGATGTCAACATGATGGGATATGCAAACTCAGATCAAACTGCATCTGGCATCCATTTTCGTCTCCGAGCTCGCTCCTTCATTGTTGCAGAACCACAAGGAAACCGTGT...

Protein

Download Protein FASTA

755 aa · TkA08G044740|TK1151|PROTEIN

MEFFQALIQKRRSIAWIWVLLLVFLLNGKPTISASNYLVGLGSYDITGPAADVNMMGYANSDQTASGIHFRLRARSFIVAEPQGNRVVFVNLDACMASQLVTIKVLERLKARYGDLYTEKNVAISGIHTHAGPGGYLQYVVYIVTSLGFVRQSFDVIVDGIEQSIIRAHENLHPGSVFVNKGDILDAGVNRSPSSYLNNPASERAKYKYDVDKEMTLLKFVDDQWGPVGSFNWFATHGTSMSRTNELISGDNKGTAARLM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G044740`
TK1151 ID	TkA08G044740
OH-1004 ID	LXL04_017862
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G044740

Location Chr08:11417753-11421613 (-)

Description Similar to NCER1: Neutral ceramidase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38010`	Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.	No verified direct reference in this release
`At1g07380`	Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.	An Arabidopsis neutral ceramidase mutant ncer1 accumulates hydroxyceramides and is sensitive to oxidative stress.2015 · DOI: 10.3389/fpls.2015.00460
`At5g58980`	Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0624000`	Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017862 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006672 ceramide metabolic process Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0042759 long-chain fatty acid biosynthetic process Biological Process

GO:0046512 sphingosine biosynthetic process Biological Process

GO:0046514 ceramide catabolic process Biological Process

GO:0090156 intracellular sphingolipid homeostasis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G07380

ath:AT2G38010

ath:AT5G58980

ddi:DDB_G0268374

dosa:Os01g0624000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.291

Rank 1 · TkA08G044740 · TK1151

Endoplasmic reticulum0.230

Rank 2 · TkA08G044740 · TK1151

Cytoplasm0.201

Rank 3 · TkA08G044740 · TK1151

Extracellular0.185

Rank 4 · TkA08G044740 · TK1151

Cell membrane0.181

Rank 5 · TkA08G044740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04734Ceramidase_alk37-589 aa

PF17048Ceramidse_alk_C591-754 aa

PF04734Ceramidase_alk631-662 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G044740	`PF04734`	Ceramidase_alk	37	589	1.4e-231	770.3
TkA08G044740	`PF17048`	Ceramidse_alk_C	591	754	3.2e-54	184.0
TkA08G044740	`PF04734`	Ceramidase_alk	631	662	1.4e-231	770.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q304B9`	Arabidopsis thaliana	sp\|Q304B9\|NCER2_ARATH Neutral ceramidase 2	74.000%	Swiss-Prot	High
`F4HQM3`	Arabidopsis thaliana	sp\|F4HQM3\|NCER1_ARATH Neutral ceramidase 1	71.200%	Swiss-Prot	High
`F4KHQ8`	Arabidopsis thaliana	sp\|F4KHQ8\|NCER3_ARATH Neutral ceramidase 3	68.000%	Swiss-Prot	High
`Q0JL46`	Oryza sativa subsp. japonica	sp\|Q0JL46\|NCASE_ORYSJ Neutral ceramidase	70.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card