TkA08G041480 | RubberDandelionOmics

Gene overview

TkA08G041480

Reference: TK1151 Chr: Chr08 Coordinates: 10558609-10564660 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3789 bp · TkA08G041480|TK1151|cDNA

TAGTTCAAAAATTATACTATTAAAAAATTAAACTCGATACAGAAATGGGTCTCCTTTCATCTCTTATCCTGAAAAAGCTGTCAGCCGGAGAGAGAGAGAGAGAGAGAGAGAGAGTAAAAGTTAACGAGAGGAGGGGAAAACAATAGCTGTAAAATTGTGCAGGGTTTTATAACACAGTTGCAGCTATAGGCTTGGCACTATACTGTGTGTACTATTTCATTTCTTGACTTTATCTTCTCCAATCCCTTCCCTACCCTCCG...

CDS

Download CDS FASTA

2943 bp · TkA08G041480|TK1151|CDS

ATGGCGTCTTTGAGAATGATGGGGGTTCTGTCGTTTCTTCTGGTTTTTTCAAGCTTCTTCGTCCTCTTCGTTAACTCCGATGACGGGGGGACATTGTTGGAGATAAAAAAGTCGTTTAGAGATGTGAATAATGTGCTTTATGACTGGACTGCTTCACCTTCTTCCGACTACTGTTCATGGCGAGGTGTTTCTTGTGATAATGTCACCTTCAATGTCGTTGCCCTTAATCTTTCAGGCTTGAATCTTGATGGGGAACTGTC...

Protein

Download Protein FASTA

980 aa · TkA08G041480|TK1151|PROTEIN

MASLRMMGVLSFLLVFSSFFVLFVNSDDGGTLLEIKKSFRDVNNVLYDWTASPSSDYCSWRGVSCDNVTFNVVALNLSGLNLDGELSPSIGELKGLLSIDLRANRLSGQIPDEIGDCSALTNLDLSFNMLTGDIPFSISKLKQLELLILKNNQLIGPIPSTLSQIPNLKILDLAQNRLNGEIPRLIYWNEVLQYLGLRSNNLVGEISPDVCQLTGLWYFDVRNNSLTGTIPSNIGNCTGFQVLDLSYNQLTGEIPFNIGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G041480`
TK1151 ID	TkA08G041480
OH-1004 ID	LXL04_017905
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G041480

Location Chr08:10558609-10564660 (-)

Description Similar to ERECTA: LRR receptor-like serine/threonine-protein kinase ERECTA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26330`	May act as a receptor kinase with ERL1 and ERL2 to regulate shoot architecture and stomatal patterning.	KNAT1 and ERECTA regulate inflorescence architecture in Arabidopsis.2002 · DOI: 10.1105/tpc.010391 Novel as1 and as2 defects in leaf adaxial-abaxial polarity reveal the requirement for ASYMMETRIC LEAVES1 and 2 and ERECTA functions in specifying leaf adaxial identity.2003 · DOI: 10.1242/dev.00622 ERECTA, an LRR receptor-like kinase protein controlling development pleiotropically affects resistance to bacterial wilt.2003 · DOI: 10.1046/j.1365-313x.2003.01877.x Synergistic interaction of three ERECTA-family receptor-like kinases controls Arabidopsis organ growth and flower development by promoting cell proliferation.2004 · DOI: 10.1242/dev.01028 ERECTA is required for protection against heat-stress in the AS1/ AS2 pathway to regulate adaxial-abaxial leaf polarity in Arabidopsis.2004 · DOI: 10.1007/s00425-004-1248-z ERECTA receptor-like kinase and heterotrimeric G protein from Arabidopsis are required for resistance to the necrotrophic fungus Plectosphaerella cucumerina.2005 · DOI: 10.1111/j.1365-313x.2005.02440.x The ERECTA gene regulates plant transpiration efficiency in Arabidopsis.2005 · DOI: 10.1038/nature03835 Pedicel development in Arabidopsis thaliana: contribution of vascular positioning and the role of the BREVIPEDICELLUS and ERECTA genes.2005 · DOI: 10.1016/j.ydbio.2005.06.011 Interaction of auxin and ERECTA in elaborating Arabidopsis inflorescence architecture revealed by the activation tagging of a new member of the YUCCA family putative flavin monooxygenases.2005 · DOI: 10.1104/pp.105.063495 ABA is an essential signal for plant resistance to pathogens affecting JA biosynthesis and the activation of defenses in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048041 Haploinsufficiency after successive loss of signaling reveals a role for ERECTA-family genes in Arabidopsis ovule development.2007 · DOI: 10.1242/dev.004788 Genetics of microenvironmental canalization in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0701936104 A strong effect of growth medium and organ type on the identification of QTLs for phytate and mineral concentrations in three Arabidopsis thaliana RIL populations.2009 · DOI: 10.1093/jxb/erp084 Polymorphic genes of major effect: consequences for variation, selection and evolution in Arabidopsis thaliana.2009 · DOI: 10.1534/genetics.108.097030 The ERECTA Receptor-Like Kinase Regulates Cell Wall-Mediated Resistance to Pathogens in Arabidopsis thaliana.2009 · DOI: 10.1094/mpmi-22-8-0953 Direct interaction of ligand-receptor pairs specifying stomatal patterning.2012 · DOI: 10.1101/gad.179895.111 Regulation of inflorescence architecture by intertissue layer ligand-receptor communication between endodermis and phloem.2012 · DOI: 10.1073/pnas.1117537109 Regulation of plant vascular stem cells by endodermis-derived EPFL-family peptide hormones and phloem-expressed ERECTA-family receptor kinases.2013 · DOI: 10.1093/jxb/ert196 A receptor-like protein acts as a specificity switch for the regulation of stomatal development.2017 · DOI: 10.1101/gad.297580.117 The Arabidopsis ERECTA gene encodes a putative receptor protein kinase with extracellular leucine-rich repeats.1996 · DOI: 10.1105/tpc.8.4.735
`At5g62230`	Receptor kinase that regulates inflorescence architecture and organ shape as well as stomatal patterning, including density and clustering, together with ER and ERL2.	Synergistic interaction of three ERECTA-family receptor-like kinases controls Arabidopsis organ growth and flower development by promoting cell proliferation.2004 · DOI: 10.1242/dev.01028 Haploinsufficiency after successive loss of signaling reveals a role for ERECTA-family genes in Arabidopsis ovule development.2007 · DOI: 10.1242/dev.004788 Direct interaction of ligand-receptor pairs specifying stomatal patterning.2012 · DOI: 10.1101/gad.179895.111 Regulation of plant vascular stem cells by endodermis-derived EPFL-family peptide hormones and phloem-expressed ERECTA-family receptor kinases.2013 · DOI: 10.1093/jxb/ert196 A receptor-like protein acts as a specificity switch for the regulation of stomatal development.2017 · DOI: 10.1101/gad.297580.117

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0203800`	Receptor kinase involved in the regulation of thermotolerance.	No verified direct reference in this release
`Os02g0777400`	Receptor kinase that may be involved in the regulation of cell proliferation and cell growth.	No verified direct reference in this release
`Os06g0130100`	Receptor kinase involved in salt drought stress responses.	Receptor-like kinase OsSIK1 improves drought and salt stress tolerance in rice (Oryza sativa) plants.2010 · DOI: 10.1111/j.1365-313x.2010.04146.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017905 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001558 regulation of cell growth Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0009944 polarity specification of adaxial/abaxial axis Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010103 stomatal complex morphogenesis Biological Process

GO:0010148 transpiration Biological Process

GO:0010286 heat acclimation Biological Process

GO:0030155 regulation of cell adhesion Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0042742 defense response to bacterium Biological Process

KEGG gene cross-reference

ath:AT2G26330

ath:AT5G62230

dosa:Os02g0777400

dosa:Os06g0130100

dosa:Os06g0203800

osa:4340000

osa:4340427

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.862

Rank 1 · TkA08G041480 · TK1151

Endoplasmic reticulum0.084

Rank 2 · TkA08G041480 · TK1151

Cytoplasm0.067

Rank 3 · TkA08G041480 · TK1151

Nucleus0.046

Rank 4 · TkA08G041480 · TK1151

Lysosome / Vacuole0.027

Rank 5 · TkA08G041480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_226-66 aa

PF29594LRR_SKP265-80 aa

PF00560LRR_173-93 aa

PF12799LRR_475-108 aa

PF24141LRR_ComC87-153 aa

PF23598LRR_1488-173 aa

PF13855LRR_890-130 aa

PF00560LRR_196-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G041480	`PF08263`	LRRNT_2	26	66	2e-11	44.7
TkA08G041480	`PF29594`	LRR_SKP2	65	80	0.0016	18.4
TkA08G041480	`PF00560`	LRR_1	73	93	3.5e-52	163.7
TkA08G041480	`PF12799`	LRR_4	75	108	2.2e-28	98.3
TkA08G041480	`PF24141`	LRR_ComC	87	153	2e-08	35.0
TkA08G041480	`PF23598`	LRR_14	88	173	9.3e-27	94.4
TkA08G041480	`PF13855`	LRR_8	90	130	3.4e-40	136.3
TkA08G041480	`PF00560`	LRR_1	96	117	3.5e-52	163.7
TkA08G041480	`PF29594`	LRR_SKP2	114	172	0.0016	18.4
TkA08G041480	`PF25013`	LRR_Zer-1	118	178	0.0015	19.4
TkA08G041480	`PF13855`	LRR_8	119	178	3.4e-40	136.3
TkA08G041480	`PF00560`	LRR_1	120	141	3.5e-52	163.7
TkA08G041480	`PF12799`	LRR_4	120	158	2.2e-28	98.3
TkA08G041480	`PF24141`	LRR_ComC	120	212	2e-08	35.0
TkA08G041480	`PF13516`	LRR_6	120	131	0.0065	17.1
TkA08G041480	`PF00560`	LRR_1	143	164	3.5e-52	163.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42371`	Arabidopsis thaliana	sp\|Q42371\|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA	85.100%	Swiss-Prot	High
`C0LGW6`	Arabidopsis thaliana	sp\|C0LGW6\|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1	62.100%	Swiss-Prot	Low
`Q69SP5`	Oryza sativa subsp. japonica	sp\|Q69SP5\|EREC1_ORYSJ LRR receptor-like serine/threonine-protein kinase ER1	74.800%	Swiss-Prot	Low
`I1Z695`	Oryza sativa subsp. japonica	sp\|I1Z695\|EREC2_ORYSJ LRR receptor-like serine/threonine-protein kinase ER2	72.200%	Swiss-Prot	Low
`Q658G7`	Oryza sativa subsp. japonica	sp\|Q658G7\|SIK1_ORYSJ LRR receptor-like serine/threonine-protein kinase SIK1	63.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card