TkA08G035860 | RubberDandelionOmics

Gene overview

TkA08G035860

Reference: TK1151 Chr: Chr08 Coordinates: 9144657-9148332 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1814 bp · TkA08G035860|TK1151|cDNA

TTTTGGGTTGATACCACACTATGCGTCTAGAACGAGAGTGTGCGTAGAGTCATTATCTTCCTCAAAGTCGTCAAATTCCCAAATTCAATCGCGTTTCTTGTCGGTGGGTGCGCGTGATTTCCTCCGTATCTCCGCCTTTCTCTACACCACGCTTCTCTGTTTTCTTTTTCTTTATTATTATTTCGTTTTCAGTTTTACAATTTCTTTAACCTCGATAGCCAGTTGGTTTGATTTCGCGTGTGCCGATTTGTCACAAACTA...

CDS

Download CDS FASTA

1173 bp · TkA08G035860|TK1151|CDS

ATGCTGGGTGGTAAAGCGATGCTTAGTTTCCTCACAAGGAAAGATGTCAGAAAAATTCTCAAGCGCAAAGACAGTGATGCTGGTGAAAGAGGAAGATCAATGGAGGAACTACGGGCTACTTTATTTAGCAAGTTTAGAAGACAACACCAATCACTATTGGGACCCACGCTTGCTCTTACATTCAATTTTGTTGCATCCGTTAGTATTATCTTGATGAATAAATTGGTACTTGTGAAAGTTGGATTCAATTATCCAATCTT...

Protein

Download Protein FASTA

390 aa · TkA08G035860|TK1151|PROTEIN

MLGGKAMLSFLTRKDVRKILKRKDSDAGERGRSMEELRATLFSKFRRQHQSLLGPTLALTFNFVASVSIILMNKLVLVKVGFNYPIFLTFIHYICSWLIMGILKALSLLPPPPSSKSTKFSSLLGLGIVMSLSTGLANVSLKFNSVGFYQMAKIAVTPAIVLAEFMLYKKKISFRKVLALTVVSIGVAVATVTDLQFHFFGACIAVAWIIPSATNKILWSNLQQQESWNALALMWKTTPITLFFLVTMMPSLDPPGVFSF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G035860`
TK1151 ID	TkA08G035860
OH-1004 ID	LXL04_017975
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G035860

Location Chr08:9144657-9148332 (-)

Description Similar to At5g57100: Nucleotide-sugar uncharacterized transporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57100`	Nucleotide-sugar uncharacterized transporter 1.	No verified direct reference in this release
`At5g55950`	Nucleotide-sugar uncharacterized transporter 2.	No verified direct reference in this release
`At1g06890`	Nucleotide-sugar transporter that transports UDP-xylose and UMP in a strict counter-exchange mode.	Identification and Characterization of a Golgi-Localized UDP-Xylose Transporter Family from Arabidopsis.2015 · DOI: 10.1105/tpc.114.133827
`At2g30460`	Nucleotide-sugar transporter that transports UDP-xylose and UMP in a strict counter-exchange mode.	No verified direct reference in this release
`At2g28315`	Nucleotide-sugar transporter that transports UDP-xylose and UMP in a strict counter-exchange mode.	Identification and Characterization of a Golgi-Localized UDP-Xylose Transporter Family from Arabidopsis.2015 · DOI: 10.1105/tpc.114.133827

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017975 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0015790 UDP-xylose transmembrane transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:1900030 regulation of pectin biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G06890

ath:AT2G28315

ath:AT5G55950

ath:AT5G57100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.500

Rank 1 · TkA08G035860 · TK1151

Endoplasmic reticulum0.239

Rank 2 · TkA08G035860 · TK1151

Cytoplasm0.116

Rank 3 · TkA08G035860 · TK1151

Cell membrane0.079

Rank 4 · TkA08G035860 · TK1151

Lysosome / Vacuole0.074

Rank 5 · TkA08G035860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13221DUF402942-105 aa

PF00892EamA54-190 aa

PF03151TPT59-337 aa

PF19120DUF5804167-199 aa

PF13221DUF4029171-185 aa

PF00892EamA233-336 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G035860	`PF13221`	DUF4029	42	105	0.74	11.2
TkA08G035860	`PF00892`	EamA	54	190	0.00037	21.5
TkA08G035860	`PF03151`	TPT	59	337	2.4e-16	60.7
TkA08G035860	`PF19120`	DUF5804	167	199	0.062	13.9
TkA08G035860	`PF13221`	DUF4029	171	185	0.74	11.2
TkA08G035860	`PF00892`	EamA	233	336	0.00037	21.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU76`	Arabidopsis thaliana	sp\|Q9LU76\|NSTU1_ARATH Nucleotide-sugar uncharacterized transporter 1	64.300%	Swiss-Prot	High
`Q9FG70`	Arabidopsis thaliana	sp\|Q9FG70\|NSTU2_ARATH Nucleotide-sugar uncharacterized transporter 2	66.700%	Swiss-Prot	High
`Q8RXL8`	Arabidopsis thaliana	sp\|Q8RXL8\|UXT3_ARATH UDP-xylose transporter 3	30.500%	Swiss-Prot	Medium
`Q8GUJ1`	Arabidopsis thaliana	sp\|Q8GUJ1\|UXT2_ARATH UDP-xylose transporter 2	29.800%	Swiss-Prot	Low
`F4IHS9`	Arabidopsis thaliana	sp\|F4IHS9\|UXT1_ARATH UDP-xylose transporter 1	30.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card