TkA08G033500 | RubberDandelionOmics

Gene overview

TkA08G033500

Reference: TK1151 Chr: Chr08 Coordinates: 8528200-8531380 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

918 bp · TkA08G033500|TK1151|CDS

ATGGCTGATTTTACAACTTCTACTCACCGAGCCAAGTGGATCTTCACTCCCCAAGATTTGAAAGATAAATACAAGGCTGCTAATCATAGAGCAAAACAGATGCTGGAGAAGTATGGATCAACAAGGGTGGATGTCGATCTTGATGGCACCTTGTCTTATCCAGAGGTTCCAACTGACCCAAAAGACAATGGTGAGAAGCATTCACGTTCAAAACCACTTAAGATAGATGAAGAACAACTTCTGCGTGCATTTTATGAGTT...

Protein

Download Protein FASTA

305 aa · TkA08G033500|TK1151|PROTEIN

MADFTTSTHRAKWIFTPQDLKDKYKAANHRAKQMLEKYGSTRVDVDLDGTLSYPEVPTDPKDNGEKHSRSKPLKIDEEQLLRAFYEFKIQDVCDAFKFPRKIQATALIYFKRFYLQWSVMEHHPKDIMLTCIYTACKAEENHVSAEELGKGIDQDHQVILNNEMVVLQSLGFDLIVYSPYRSIDGFIDDMEDLHETAKMVADKMMRSEAPLLFSPGQLALAALRRSNEEYQVLDFERYLNNTLSRQHPVRTVSELLVYLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G033500`
TK1151 ID	TkA08G033500
OH-1004 ID	LXL04_006569
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	93.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G033500

Location Chr08:8528200-8531380 (-)

Description Similar to CYCH1-1: Cyclin-H1-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g27620`	Associates with CDK-2 and CDK-3 and activates the CDK kinases.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0737600`	Involved in cell cycle regulation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006569 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009637 response to blue light Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0050821 protein stabilization Biological Process

GO:0051301 cell division Biological Process

GO:0072593 reactive oxygen species metabolic process Biological Process

GO:1990069 stomatal opening Biological Process

GO:2000045 regulation of G1/S transition of mitotic cell cycle Biological Process

GO:2000070 regulation of response to water deprivation Biological Process

KEGG gene cross-reference

ath:AT5G27620

dosa:Os03g0737600

mmu:66671

rno:84389

xla:394356

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.889

Rank 1 · TkA08G033500 · TK1151

Cytoplasm0.215

Rank 2 · TkA08G033500 · TK1151

Cell membrane0.027

Rank 3 · TkA08G033500 · TK1151

Mitochondrion0.024

Rank 4 · TkA08G033500 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA08G033500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28028Amuc_110015-37 aa

PF16899Cyclin_C_218-37 aa

PF00134Cyclin_N82-174 aa

PF01857RB_B87-147 aa

PF00382TFIIB88-148 aa

PF16899Cyclin_C_290-155 aa

PF29928BUR2_N102-145 aa

PF16899Cyclin_C_2188-266 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G033500	`PF28028`	Amuc_1100	15	37	0.16	12.0
TkA08G033500	`PF16899`	Cyclin_C_2	18	37	2.2e-09	38.3
TkA08G033500	`PF00134`	Cyclin_N	82	174	3.1e-11	43.8
TkA08G033500	`PF01857`	RB_B	87	147	0.02	15.6
TkA08G033500	`PF00382`	TFIIB	88	148	1e-07	32.6
TkA08G033500	`PF16899`	Cyclin_C_2	90	155	2.2e-09	38.3
TkA08G033500	`PF29928`	BUR2_N	102	145	0.13	13.0
TkA08G033500	`PF16899`	Cyclin_C_2	188	266	2.2e-09	38.3
TkA08G033500	`PF00134`	Cyclin_N	227	247	3.1e-11	43.8
TkA08G033500	`PF28028`	Amuc_1100	232	283	0.16	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W5S1`	Arabidopsis thaliana	sp\|Q8W5S1\|CCH11_ARATH Cyclin-H1-1	58.600%	Swiss-Prot	High
`Q10D80`	Oryza sativa subsp. japonica	sp\|Q10D80\|CCH11_ORYSJ Cyclin-H1-1	59.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card