TkA08G032710 | RubberDandelionOmics

Gene overview

TkA08G032710

Reference: TK1151 Chr: Chr08 Coordinates: 8327719-8332644 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2630 bp · TkA08G032710|TK1151|cDNA

CGGCTGAGCGCAACTGCGGTGCACGATAGCAAGCCACCCTTTGCCAAAACCGTCAAAGAATCTCGAGAGTCGTCACTAACACGAGATAAATATAAAAATCCATAAAATCGAAACCCTAATTTGCAGAGAGTCCGCGCTTCTCTCTCAAACAAAATCTGCTCAAGTGCGTCGTCATCGTTCGTTGCTCCAACTGGATTGGCGCTGTACGTATCCCTTCCTATATAATTTGTGTATTTACTGTGAGGATTATGATGCTTGTG...

CDS

Download CDS FASTA

831 bp · TkA08G032710|TK1151|CDS

ATGGGTAATGGTCCAGCACCTTTCACAGATATTGGCAAACGAGCAAAAGATCTGTTGACAAAAGATTACAACTATGACCACAAGTTTGTATTATCAGTTCCCGGATCTACCCCTATGGGATTGACAGCTACTGGTTTGAAAAAAGGTCAAATATTTCTTGGAGATATAAGTGCTCAGTACAAGAGTGGCAGGACTGTTGTAGATGTAAAAGTCGATACATATTCAAATGTGTCAACAAAAGTAACAGTTGATGAATTAAT...

Protein

Download Protein FASTA

276 aa · TkA08G032710|TK1151|PROTEIN

MGNGPAPFTDIGKRAKDLLTKDYNYDHKFVLSVPGSTPMGLTATGLKKGQIFLGDISAQYKSGRTVVDVKVDTYSNVSTKVTVDELMPSTKAILSFDVPDHKSGKLDLQYLHPRIAIDSSIGLNPSPVLNLAAAVGGKDILLGGEVGFDTASASFTKYTAGITFNKPDLSAALILTDKGQTLKASYVHSVDPSHTTQVVAEMTHRLNTFENSFTIGSAHVVDRYNTVKTRFSDTGKLAMVCQREWRPKSMITFSAEYDAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G032710`
TK1151 ID	TkA08G032710
OH-1004 ID	LXL04_018027
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G032710

Location Chr08:8327719-8332644 (-)

Description Similar to VDAC4: Mitochondrial outer membrane protein porin 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57490`	Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules.	Molecular and genetic characterization of the gene family encoding the voltage-dependent anion channel in Arabidopsis.2011 · DOI: 10.1093/jxb/err113

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0137500`	Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules.	No verified direct reference in this release
`Os03g0202200`	Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018027 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0046930 pore complex Cellular Component

GO:0008308 voltage-gated monoatomic anion channel activity Molecular Function

GO:0015288 porin activity Molecular Function

KEGG gene cross-reference

ath:AT5G57490

dosa:Os03g0137500

dosa:Os03g0202200

sot:102580103

sot:102603136

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.946

Rank 1 · TkA08G032710 · TK1151

Cytoplasm0.077

Rank 2 · TkA08G032710 · TK1151

Nucleus0.054

Rank 3 · TkA08G032710 · TK1151

Cell membrane0.052

Rank 4 · TkA08G032710 · TK1151

Plastid0.017

Rank 5 · TkA08G032710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01459Porin_34-262 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G032710	`PF01459`	Porin_3	4	262	5.2e-63	213.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKM2`	Arabidopsis thaliana	sp\|Q9FKM2\|VDAC4_ARATH Mitochondrial outer membrane protein porin 4	60.500%	Swiss-Prot	High
`Q10S27`	Oryza sativa subsp. japonica	sp\|Q10S27\|VDAC6_ORYSJ Mitochondrial outer membrane protein porin 6	55.800%	Swiss-Prot	High
`Q84P97`	Oryza sativa subsp. japonica	sp\|Q84P97\|VDAC5_ORYSJ Mitochondrial outer membrane protein porin 5	49.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card