TkA08G031010 | RubberDandelionOmics

Gene overview

TkA08G031010

Reference: TK1151 Chr: Chr08 Coordinates: 7914687-7917085 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1124 bp · TkA08G031010|TK1151|cDNA

TGAATTCAAATCGTCCACACGCAATCTGCCTAATTGATCCTTACTCGCTATCCGAATTTCACTTTCTTTCATCCCCAATCAGACATCAATATCAATGATCGCTACAGATTGGGGATACGCGGCTAAGCAATTCGTCAAGAGGCTTCCCGATAAAGTTGTTGTTCACTGCAGCGAGTGCAATTCATCGACCTTGACCTTCGATGGAGTTGATCGGATGGGTGAAAGGTTAGCAGAAGAGGTAGTCGCAGTTACCAAACGGT...

CDS

Download CDS FASTA

1200 bp · TkA08G031010|TK1151|CDS

ATGTTTGCCATCCCTACAAAACCCCAATTTCATCCCCTGATTTGCAATTGCTTCAATCCAGGGTTTCAATCAGGGCATCCGAGGATACTGTCTGTTCCAGGTGGTTCAGAAATGGACTTGATTCCGAAATTAGGGAAGCTGTTTTTTGTTAGCCAGCAGAGTAAACCGAATCAGGCGGTGGAAGTGATCGAGACGGATAATAATGCGGTTAGCTGTAAAGTTGGTTTCGATGCCGTGTCGTCTGGAACAAAATCCCAACC...

Protein

Download Protein FASTA

399 aa · TkA08G031010|TK1151|PROTEIN

MFAIPTKPQFHPLICNCFNPGFQSGHPRILSVPGGSEMDLIPKLGKLFFVSQQSKPNQAVEVIETDNNAVSCKVGFDAVSSGTKSQPDHLVIMVNGIIGSATDWGYAAKQFVKRLPDKVVVHCSECNSSTLTFDGVDRMGERLAEEVVAVTKRWPEVSKISFVAHSLGGLVARYAIGKLYENCPVNRIAGLQPVNFITVATPHLGSRGHKQLPLLCGVPFLERSASQTAHWIAGRSGKHLFLTDNDDGDLPLLLQMVNDT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G031010`
TK1151 ID	TkA08G031010
OH-1004 ID	LXL04_018057
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G031010`
Location	Chr08:7914687-7917085 (-)
Description	Similar to SPAC4A8.10: Putative lipase C4A8.10 (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018057` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006629 lipid metabolic process Biological Process GO:0016042 lipid catabolic process Biological Process GO:0055088 lipid homeostasis Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005811 lipid droplet Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0004622 phosphatidylcholine lysophospholipase A1 activity Molecular Function GO:0004623 A2-type glycerophospholipase activity Molecular Function GO:0047372 monoacylglycerol lipase activity Molecular Function
KEGG gene cross-reference	sce:YDL109C sce:YDR444W sce:YGL144C sce:YOR059C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.687

Rank 1 · TkA08G031010 · TK1151

Cytoplasm0.101

Rank 2 · TkA08G031010 · TK1151

Mitochondrion0.095

Rank 3 · TkA08G031010 · TK1151

Golgi apparatus0.077

Rank 4 · TkA08G031010 · TK1151

Nucleus0.073

Rank 5 · TkA08G031010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05057DUF67685-293 aa

PF02089Palm_thioest91-216 aa

PF12697Abhydrolase_691-199 aa

PF00561Abhydrolase_192-116 aa

PF01764Lipase_3109-211 aa

PF24096DUF7379150-206 aa

PF01674Lipase_2154-178 aa

PF07819PGAP1155-203 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G031010	`PF05057`	DUF676	85	293	1.1e-70	238.3
TkA08G031010	`PF02089`	Palm_thioest	91	216	9.5e-05	22.9
TkA08G031010	`PF12697`	Abhydrolase_6	91	199	0.0032	18.8
TkA08G031010	`PF00561`	Abhydrolase_1	92	116	0.12	12.7
TkA08G031010	`PF01764`	Lipase_3	109	211	0.0023	18.6
TkA08G031010	`PF24096`	DUF7379	150	206	0.068	13.2
TkA08G031010	`PF01674`	Lipase_2	154	178	0.18	12.0
TkA08G031010	`PF07819`	PGAP1	155	203	0.013	16.0
TkA08G031010	`PF02450`	LCAT	156	206	0.061	13.3
TkA08G031010	`PF00561`	Abhydrolase_1	158	189	0.12	12.7
TkA08G031010	`PF00561`	Abhydrolase_1	256	317	0.12	12.7
TkA08G031010	`PF02450`	LCAT	304	394	0.061	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card