TkA08G029920 | RubberDandelionOmics

Gene overview

TkA08G029920

Reference: TK1151 Chr: Chr08 Coordinates: 7661802-7663972 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

937 bp · TkA08G029920|TK1151|cDNA

GTGAGCCGTCGTATTCTGGTGTTGGCTGTTCATGGTGTCAATGGCGGGCTCAACTGAAACCTCAAAATGGCTCACTTTATCCATCACACTCACTATCGCCACCGTTTCTGCATCCGCCGCCTTCTCGGTTTACTACTGGAGCAACAGAAGAACAAAAGATTCCAATGATAAGCTTATAAAGGAACTTCAGAAATCTCTGAATGAAGCATTAGTAAAGTGTTCTGCTGAGAGGCAAGGCCGAATTAGAGCTCAACAGGATT...

CDS

Download CDS FASTA

906 bp · TkA08G029920|TK1151|CDS

ATGGTGTCAATGGCGGGCTCAACTGAAACCTCAAAATGGCTCACTTTATCCATCACACTCACTATCGCCACCGTTTCTGCATCCGCCGCCTTCTCGGTTTACTACTGGAGCAACAGAAGAACAAAAGATTCCAATGATAAGCTTATAAAGGAACTTCAGAAATCTCTGAATGAAGCATTAGTAAAGTGTTCTGCTGAGAGGCAAGGCCGAATTAGAGCTCAACAGGATTTAAGAAAAGCAATGCTCCAAGTTAAAACAGA...

Protein

Download Protein FASTA

302 aa · TkA08G029920|TK1151|PROTEIN

MVSMAGSTETSKWLTLSITLTIATVSASAAFSVYYWSNRRTKDSNDKLIKELQKSLNEALVKCSAERQGRIRAQQDLRKAMLQVKTDNSEMIYPMAPIAIIRSCFSTRNGTPRQPLIVPLARAHLTFDTSRVPPSSLEDIEEYSHCWIIYVFHLNTDLDKLWKDPSRSKLKAKVRVPRLKGEKKGLFATRSPHRPCPIGLTVAKVESVKGNIILLSGVDLVDGTPVLDVKPYLPYCDSIKEAIVPDWVKMNDMLAVGSVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G029920`
TK1151 ID	TkA08G029920
OH-1004 ID	LXL04_018064
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 85.795 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G029920`
Location	Chr08:7661802-7663972 (+)
Description	Similar to TRMO: tRNA (adenine(37)-N6)-methyltransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018064` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0030488 tRNA methylation Biological Process GO:0032259 methylation Biological Process GO:0003723 RNA binding Molecular Function GO:0089715 tRNA (L-threonylcarbamoyladenosine(37)-C2) methyltransferase activity Molecular Function
KEGG gene cross-reference	hsa:51531 mmu:74753 pae:PA3388 rno:298072 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.293

Rank 1 · TkA08G029920 · TK1151

Nucleus0.234

Rank 2 · TkA08G029920 · TK1151

Plastid0.216

Rank 3 · TkA08G029920 · TK1151

Mitochondrion0.154

Rank 4 · TkA08G029920 · TK1151

Peroxisome0.134

Rank 5 · TkA08G029920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07569Hira27-85 aa

PF01980TrmO_N100-238 aa

PF07569Hira136-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G029920	`PF07569`	Hira	27	85	0.0083	16.5
TkA08G029920	`PF01980`	TrmO_N	100	238	4.2e-45	153.6
TkA08G029920	`PF07569`	Hira	136	156	0.0083	16.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card