TkA08G029850 | RubberDandelionOmics

Gene overview

TkA08G029850

Reference: TK1151 Chr: Chr08 Coordinates: 7636991-7638582 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1293 bp · TkA08G029850|TK1151|cDNA

AAACACGGAACAACAACAACCGCCAACTTATTCCCTGAAGACCACGAGCCATGGCAGAAACGAATACTTGATCCAGGGAGTGAAATCGTCCTAAAATGGAACCGAATCTTCATAGTCTCATGCTTACTTGCATTATTCATCGATCCATGGTACTTCTATCTACCCGGCATATTACAAAACGAAGATTCATGGTGTGTGAAAACGGATCTAAATCTGAGAATCGTTGTCACTGCTTTTCGGACATTAGCAGATTTGTTTTA...

CDS

Download CDS FASTA

1293 bp · TkA08G029850|TK1151|CDS

AAACACGGAACAACAACAACCGCCAACTTATTCCCTGAAGACCACGAGCCATGGCAGAAACGAATACTTGATCCAGGGAGTGAAATCGTCCTAAAATGGAACCGAATCTTCATAGTCTCATGCTTACTTGCATTATTCATCGATCCATGGTACTTCTATCTACCCGGCATATTACAAAACGAAGATTCATGGTGTGTGAAAACGGATCTAAATCTGAGAATCGTTGTCACTGCTTTTCGGACATTAGCAGATTTGTTTTA...

Protein

Download Protein FASTA

431 aa · TkA08G029850|TK1151|PROTEIN

KHGTTTTANLFPEDHEPWQKRILDPGSEIVLKWNRIFIVSCLLALFIDPWYFYLPGILQNEDSWCVKTDLNLRIVVTAFRTLADLFYMLHVVIKFRTAYIAPSSRVFGRGELVMDPKMIAKRYIRTDFFIDLIATLPLPQIVIWFIIPATRTSKANHNNNALALIVLLQYIPRLYLIFPLSSELVKATGVVTKTAWAGAAYNLMLYMLASHVLGAAWYLLSIDRHMSCWKSICKDEKATCKAIYLDCGMMNDIGRKNWAN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G029850`
TK1151 ID	TkA08G029850
OH-1004 ID	LXL04_018067
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 60.534 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G029850

Location Chr08:7636991-7638582 (+)

Description Similar to CNGC17: Cyclic nucleotide-gated ion channel 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30360`	Probable cyclic nucleotide-gated ion channel.	Phytosulfokine Regulates Growth in Arabidopsis through a Response Module at the Plasma Membrane That Includes CYCLIC NUCLEOTIDE-GATED CHANNEL17, H+-ATPase, and BAK1.2015 · DOI: 10.1105/tpc.15.00306
`At2g24610`	Probable cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At5g14870`	Cyclic nucleotide-gated ion channel required for directional pollen tube growth into the transmitting tract.	A cyclic nucleotide-gated channel is essential for polarized tip growth of pollen.2007 · DOI: 10.1073/pnas.0701781104 Cyclic nucleotide-gated channel 18 is an essential Ca2+ channel in pollen tube tips for pollen tube guidance to ovules in Arabidopsis.2016 · DOI: 10.1073/pnas.1524629113
`At2g28260`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At1g15990`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018067 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0030659 cytoplasmic vesicle membrane Cellular Component

GO:0031965 nuclear membrane Cellular Component

GO:0005216 monoatomic ion channel activity Molecular Function

GO:0005249 voltage-gated potassium channel activity Molecular Function

GO:0005262 calcium channel activity Molecular Function

KEGG gene cross-reference

ath:AT2G24610

ath:AT3G48010

ath:AT4G30360

ath:AT5G14870

mtr:25487817

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.899

Rank 1 · TkA08G029850 · TK1151

Cytoplasm0.094

Rank 2 · TkA08G029850 · TK1151

Endoplasmic reticulum0.040

Rank 3 · TkA08G029850 · TK1151

Mitochondrion0.022

Rank 4 · TkA08G029850 · TK1151

Nucleus0.021

Rank 5 · TkA08G029850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520Ion_trans34-354 aa

PF14015DUF4231140-168 aa

PF14015DUF4231328-389 aa

PF18215Rtt106_N375-389 aa

PF18215Rtt106_N404-417 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G029850	`PF00520`	Ion_trans	34	354	1.7e-19	70.7
TkA08G029850	`PF14015`	DUF4231	140	168	0.7	11.1
TkA08G029850	`PF14015`	DUF4231	328	389	0.7	11.1
TkA08G029850	`PF18215`	Rtt106_N	375	389	0.061	13.9
TkA08G029850	`PF18215`	Rtt106_N	404	417	0.061	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7Z0`	Arabidopsis thaliana	sp\|Q8L7Z0\|CNG17_ARATH Cyclic nucleotide-gated ion channel 17	71.400%	Swiss-Prot	High
`Q9SJA4`	Arabidopsis thaliana	sp\|Q9SJA4\|CNG14_ARATH Probable cyclic nucleotide-gated ion channel 14	65.300%	Swiss-Prot	High
`Q9LEQ3`	Arabidopsis thaliana	sp\|Q9LEQ3\|CNG18_ARATH Cyclic nucleotide-gated ion channel 18	58.700%	Swiss-Prot	High
`Q9SL29`	Arabidopsis thaliana	sp\|Q9SL29\|CNG15_ARATH Putative cyclic nucleotide-gated ion channel 15	56.100%	Swiss-Prot	High
`Q9S9N5`	Arabidopsis thaliana	sp\|Q9S9N5\|CNGC7_ARATH Putative cyclic nucleotide-gated ion channel 7	50.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card