TkA08G028670 | RubberDandelionOmics

Gene overview

TkA08G028670

Reference: TK1151 Chr: Chr08 Coordinates: 7370409-7371276 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

495 bp · TkA08G028670|TK1151|cDNA

ATGGATGAAATTCATCTTCCATCGCAAAACCCCAACCCCAATGAGACTTATGATCAAATTCCACAGCCCACACAACCAAGTGCACATGCTGCTACACAAGCTGTTGGGACAGCTGCTGCACAAGCAGATGGTGGAACATCTACTGCACAGGTTGCTGGTGCAGGACCATCTGATGCACAGGTTGCTGGTGCAGGACCATCTGCTGCACAGGCTGATGCACAACCTGTTGGAACAGCTGAAGCACAAGATATTGGTACAAA...

CDS

Download CDS FASTA

495 bp · TkA08G028670|TK1151|CDS

ATGGATGAAATTCATCTTCCATCGCAAAACCCCAACCCCAATGAGACTTATGATCAAATTCCACAGCCCACACAACCAAGTGCACATGCTGCTACACAAGCTGTTGGGACAGCTGCTGCACAAGCAGATGGTGGAACATCTACTGCACAGGTTGCTGGTGCAGGACCATCTGATGCACAGGTTGCTGGTGCAGGACCATCTGCTGCACAGGCTGATGCACAACCTGTTGGAACAGCTGAAGCACAAGATATTGGTACAAA...

Protein

Download Protein FASTA

164 aa · TkA08G028670|TK1151|PROTEIN

MDEIHLPSQNPNPNETYDQIPQPTQPSAHAATQAVGTAAAQADGGTSTAQVAGAGPSDAQVAGAGPSAAQADAQPVGTAEAQDIGTNRKLTSVVWNHFKREKIDGEWKAICNYCRKKLSGKGSHGTKHLHDHYKACMPRKTKAMRMFFWTILRTFCCCFIYFSN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G028670`
TK1151 ID	TkA08G028670
OH-1004 ID	LXL04_023706
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.500
Protein coverage (%)	TK1151 88.415 / OH-1004 60.417 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G028670`
Location	Chr08:7370409-7371276 (-)
Description	Similar to Os05g0583200: Zinc finger BED domain-containing protein RICESLEEPER 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_023706` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0009791 post-embryonic development Biological Process GO:0032196 transposition Biological Process GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0003677 DNA binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0046983 protein dimerization activity Molecular Function
KEGG gene cross-reference	ath:AT3G42170 dosa:Os01g0518400 dosa:Os05g0583200 osa:4339741 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.923

Rank 1 · TkA08G028670 · TK1151

Cytoplasm0.162

Rank 2 · TkA08G028670 · TK1151

Mitochondrion0.031

Rank 3 · TkA08G028670 · TK1151

Cell membrane0.021

Rank 4 · TkA08G028670 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkA08G028670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02892zf-BED92-132 aa

PF14471DUF442898-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G028670	`PF02892`	zf-BED	92	132	4.8e-07	30.4
TkA08G028670	`PF14471`	DUF4428	98	127	0.0091	16.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card