TkA08G027090 | RubberDandelionOmics

Gene overview

TkA08G027090

Reference: TK1151 Chr: Chr08 Coordinates: 7018889-7021676 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

987 bp · TkA08G027090|TK1151|cDNA

ATGAACACGAATTCTGTAGCTATCACGAAGACCAAGAGGACTCGGAAAACAGTACCTCGTGACTCACCTCCTCGAAGAAGTTCCATTTATCGGGGTGTTACAAGGCATCGATGGACTGGGAGATATGAAGCTCACTTATGGGATAAGAACTGTTGGAATGAGTCTCAGAACAAGAAAGGCCGGCAAGGTGCTTACGATGACGAAGATGCAGCTGCTCATGCGTATGACTTGGCTGCTCTTAAGTATTGGGGCCCGGACAC...

CDS

Download CDS FASTA

987 bp · TkA08G027090|TK1151|CDS

ATGAACACGAATTCTGTAGCTATCACGAAGACCAAGAGGACTCGGAAAACAGTACCTCGTGACTCACCTCCTCGAAGAAGTTCCATTTATCGGGGTGTTACAAGGCATCGATGGACTGGGAGATATGAAGCTCACTTATGGGATAAGAACTGTTGGAATGAGTCTCAGAACAAGAAAGGCCGGCAAGGTGCTTACGATGACGAAGATGCAGCTGCTCATGCGTATGACTTGGCTGCTCTTAAGTATTGGGGCCCGGACAC...

Protein

Download Protein FASTA

328 aa · TkA08G027090|TK1151|PROTEIN

MNTNSVAITKTKRTRKTVPRDSPPRRSSIYRGVTRHRWTGRYEAHLWDKNCWNESQNKKGRQGAYDDEDAAAHAYDLAALKYWGPDTILNFPLVTYHKELKDMEGQSREEYIGSLRRKSSGFSRGVSKYRGVARHHHNGRWEARIGRVFGNKYLYLGTYATQEEAAVAYDMAAIEYRGLNAVTNFDLSRYIKWLRPDNNGTVVTPPNPNINIIDATLPPSTDNNENQPIPAMVSPTMPYSSRSTTATSALGLLLQSSKFR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G027090`
TK1151 ID	TkA08G027090
OH-1004 ID	LXL04_018093
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 95.211 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G027090

Location Chr08:7018889-7021676 (+)

Description Similar to At1g16060: AP2-like ethylene-responsive transcription factor At1g16060

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16060`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At3g54320`	May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity).	Contrapuntal networks of gene expression during Arabidopsis seed filling.2002 · DOI: 10.1105/tpc.000877 WRINKLED1 encodes an AP2/EREB domain protein involved in the control of storage compound biosynthesis in Arabidopsis.2004 · DOI: 10.1111/j.1365-313x.2004.02235.x ACTIVATOR of Spomin::LUC1/WRINKLED1 of Arabidopsis thaliana transactivates sugar-inducible promoters.2005 · DOI: 10.1093/pcp/pci072 A spatiotemporal analysis of enzymatic activities associated with carbon metabolism in wild-type and mutant embryos of Arabidopsis using in situ histochemistry.2006 · DOI: 10.1111/j.1365-313x.2006.02682.x WRI1 is required for seed germination and seedling establishment.2006 · DOI: 10.1104/pp.106.079574 wrinkled1: A novel, low-seed-oil mutant of Arabidopsis with a deficiency in the seed-specific regulation of carbohydrate metabolism.1998 · DOI: 10.1104/pp.118.1.91
`At1g79700`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g57390`	Probably acts as a transcriptional activator.	AINTEGUMENTA-like (AIL) genes are expressed in young tissues and may specify meristematic or division-competent states.2005 · DOI: 10.1007/s11103-005-0955-6
`At1g72570`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018093 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006109 regulation of carbohydrate metabolic process Biological Process

GO:0006110 regulation of glycolytic process Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0008610 lipid biosynthetic process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009845 seed germination Biological Process

KEGG gene cross-reference

ath:AT1G16060

ath:AT1G72570

ath:AT1G79700

ath:AT3G54320

ath:AT5G57390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.952

Rank 1 · TkA08G027090 · TK1151

Cytoplasm0.095

Rank 2 · TkA08G027090 · TK1151

Cell membrane0.028

Rank 3 · TkA08G027090 · TK1151

Endoplasmic reticulum0.022

Rank 4 · TkA08G027090 · TK1151

Plastid0.021

Rank 5 · TkA08G027090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP230-84 aa

PF00847AP2127-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G027090	`PF00847`	AP2	30	84	9e-19	68.2
TkA08G027090	`PF00847`	AP2	127	178	9e-19	68.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AN4`	Arabidopsis thaliana	sp\|Q94AN4\|AP2L1_ARATH AP2-like ethylene-responsive transcription factor At1g16060	58.900%	Swiss-Prot	High
`Q6X5Y6`	Arabidopsis thaliana	sp\|Q6X5Y6\|WRI1_ARATH Ethylene-responsive transcription factor WRI1	81.000%	Swiss-Prot	Medium
`A0JPZ8`	Arabidopsis thaliana	sp\|A0JPZ8\|AP2L3_ARATH AP2-like ethylene-responsive transcription factor At1g79700	75.800%	Swiss-Prot	Medium
`Q6PQQ3`	Arabidopsis thaliana	sp\|Q6PQQ3\|AIL5_ARATH AP2-like ethylene-responsive transcription factor AIL5	71.400%	Swiss-Prot	Medium
`Q1PFE1`	Arabidopsis thaliana	sp\|Q1PFE1\|AIL1_ARATH AP2-like ethylene-responsive transcription factor AIL1	65.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card