TkA08G026810 | RubberDandelionOmics

Gene overview

TkA08G026810

Reference: TK1151 Chr: Chr08 Coordinates: 6929905-6937650 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5746 bp · TkA08G026810|TK1151|cDNA

AAAACAAAAACCCACCGCATTAGGAAACGACGAAATAGTTACAGGAAACCACGAATTGCCCCTTCGGTAACAGTAAAAATAGTCGAAATTACACACACATAGACACATAGTCGCATACACATGCATATAAATCATCAAGGCTTCTCGAGTAAATCTTCTGTTCTTCCAATACTTGATTGTGGATGTGGAGGAAGAACAGAAAAGATACAGAAAAGATCAAAATTTTTCTTTCTATGTGTTGTGCCTTGTGGGTTACTCTT...

CDS

Download CDS FASTA

3114 bp · TkA08G026810|TK1151|CDS

ATGAGTTCTAGTGGCGGTGGCTCAGAGGGCGTTATACAAAGGGGAAAGCTTATAGTTCACATAGCCGAAAATGGCCATTCTTTTGATCTCAATTGTGACGAATATACCCTTGTTGAAGCTGTTCAAAGGTACCTGGAATCACTTTCAGGGATACCCTTAAACGACCAACTTCTTCTCTATCTGGACATGAAATTAGAACCCCAACAACCGCTTTCTGTATACAAACTCCCTTCAGATGATCGCGAAGTGTTCTTATTCAA...

Protein

Download Protein FASTA

1037 aa · TkA08G026810|TK1151|PROTEIN

MSSSGGGSEGVIQRGKLIVHIAENGHSFDLNCDEYTLVEAVQRYLESLSGIPLNDQLLLYLDMKLEPQQPLSVYKLPSDDREVFLFNRAKMRTNSTPPQPVDLQPPDHIHPDPPKPSSSSHEPHPLDEASDPALKALPSYEIQFRYHYQLGDSIYRRTLSKYEACERLSREQRVQEKALEIARGNLDHIYKMILHNYSDFVKRYSHQQRAHTNLLVNFWKDLERLRNIKLVPALQSDNRKCLSDFVKEENLRKMVEDCGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G026810`
TK1151 ID	TkA08G026810
OH-1004 ID	LXL04_018100
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G026810

Location Chr08:6929905-6937650 (+)

Description Similar to ATG11: Autophagy-related protein 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30790`	Accessory protein involved in autophagy.	AUTOPHAGY-RELATED11 plays a critical role in general autophagy- and senescence-induced mitophagy in Arabidopsis.2014 · DOI: 10.1105/tpc.113.120014

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018100 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000422 autophagy of mitochondrion Biological Process

GO:0000425 pexophagy Biological Process

GO:0006914 autophagy Biological Process

GO:0010150 leaf senescence Biological Process

GO:0015031 protein transport Biological Process

GO:0034517 ribophagy Biological Process

GO:0034727 piecemeal microautophagy of the nucleus Biological Process

GO:0061709 reticulophagy Biological Process

GO:0005634 nucleus Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005776 autophagosome Cellular Component

KEGG gene cross-reference

ath:AT4G30790

mgr:MGG_04486

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.588

Rank 1 · TkA08G026810 · TK1151

Nucleus0.220

Rank 2 · TkA08G026810 · TK1151

Golgi apparatus0.205

Rank 3 · TkA08G026810 · TK1151

Cell membrane0.171

Rank 4 · TkA08G026810 · TK1151

Lysosome / Vacuole0.126

Rank 5 · TkA08G026810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00240ubiquitin23-79 aa

PF12179IKKbetaNEMObind37-49 aa

PF04108ATG17_like157-487 aa

PF29964NEJ1_C235-273 aa

PF10377ATG11302-329 aa

PF12179IKKbetaNEMObind302-317 aa

PF10377ATG11376-407 aa

PF29964NEJ1_C600-645 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G026810	`PF00240`	ubiquitin	23	79	0.015	15.8
TkA08G026810	`PF12179`	IKKbetaNEMObind	37	49	9.6	6.8
TkA08G026810	`PF04108`	ATG17_like	157	487	9.6e-28	98.4
TkA08G026810	`PF29964`	NEJ1_C	235	273	0.55	10.6
TkA08G026810	`PF10377`	ATG11	302	329	4.6e-23	82.5
TkA08G026810	`PF12179`	IKKbetaNEMObind	302	317	9.6	6.8
TkA08G026810	`PF10377`	ATG11	376	407	4.6e-23	82.5
TkA08G026810	`PF29964`	NEJ1_C	600	645	0.55	10.6
TkA08G026810	`PF12179`	IKKbetaNEMObind	618	628	9.6	6.8
TkA08G026810	`PF12179`	IKKbetaNEMObind	741	757	9.6	6.8
TkA08G026810	`PF12179`	IKKbetaNEMObind	776	800	9.6	6.8
TkA08G026810	`PF04108`	ATG17_like	810	917	9.6e-28	98.4
TkA08G026810	`PF10377`	ATG11	888	1023	4.6e-23	82.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUG7`	Arabidopsis thaliana	sp\|Q9SUG7\|ATG11_ARATH Autophagy-related protein 11	53.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card