Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1501 bp · TkA08G026370|TK1151|cDNA
GGTTTTTTTGTAAGGATTAACCGGTTTCAGGGACTTATCTGCTAATAAAATAAATTGAGTGACTTAATCGTCAGAAGTCCCAAAAGTGAGGGACTTTTAAGCCTTCGCCCTAAAGTCACTAATTTTGTTAACATTCTCTCTTCAACCCTCTCTCTAAGGGAAACAAATCCACGGCAAAAGGAATTCATCTTCCCTATCTCGCACTCCAAAAAAATGAAGCGTCAAGCGCTTGAAGAGCAACGTTGCTACCATCCAACCAG...
819 bp · TkA08G026370|TK1151|CDS
ATGGCTAGGCTTACTACAAGCTCCGTCGTCCCGTCTCTTAAACAGCCAATTGCCATCGGTTCCTTGCAGCCAAAGTTCTATAGTCTCCGCCTGGAATTCCCTAATCTAAATGTTGTCCGTGGCTATCGGATTACCTGCCGTTATGGAGGAGGAGCTAGTTCACGTCAGCAAGACTCGAGGCGGTCTCCTCAACTTAGCTCTGATGATGATCAAGCCAGGGATGTCTCCACTATCAGTAGGTCAAATACGGTGAGGCTTAT...
Protein
Download Protein FASTA272 aa · TkA08G026370|TK1151|PROTEIN
MARLTTSSVVPSLKQPIAIGSLQPKFYSLRLEFPNLNVVRGYRITCRYGGGASSRQQDSRRSPQLSSDDDQARDVSTISRSNTVRLIDDQQNMVGIISKTAAIQMAEDAELDLVILSPDADPPVVKLMDYNKYRYEQQKKKREQQKKSAALRMDQKELKMGYNIDVHDYSVRLRAAHKFLKDGDKVKVIVNLKGRQNEFRKNAIELLNRFRNDIGELGIEESKNLRDRNMFMVLIPNKLVVQKEAPKGKRKDNISYPVRT...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G026370 |
|---|---|
| TK1151 ID | TkA08G026370 |
| OH-1004 ID | LXL04_018110 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 89.200 |
| Protein coverage (%) | TK1151 92.279 / OH-1004 97.656Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G026370 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:6794609-6800337 (-) | |||||||||
| Description | Similar to IF3-4: Translation initiation factor IF3-4, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009658 chloroplast organization Biological Process GO:0032790 ribosome disassembly Biological Process GO:0048366 leaf development Biological Process GO:0005737 cytoplasm Cellular Component GO:0005773 vacuole Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component GO:0003729 mRNA binding Molecular Function GO:0003743 translation initiation factor activity Molecular Function | |||||||||
| KEGG gene cross-reference | ana:all4623 ath:AT2G24060 ath:AT4G30690 ava:Ava_2038 npu:Npun_F6393 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF28557DUF843975-105 aaPF05198IF3_N80-144 aaPF08797HIRAN81-105 aaPF28557DUF8439141-165 aaPF00707IF3_C155-237 aaPF08797HIRAN163-224 aaPF28557DUF8439172-213 aaPF28557DUF8439225-240 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G026370 | PF28557 | DUF8439 | 75 | 105 | 0.37 | 11.8 |
| TkA08G026370 | PF05198 | IF3_N | 80 | 144 | 8.3e-26 | 90.7 |
| TkA08G026370 | PF08797 | HIRAN | 81 | 105 | 0.025 | 15.1 |
| TkA08G026370 | PF28557 | DUF8439 | 141 | 165 | 0.37 | 11.8 |
| TkA08G026370 | PF00707 | IF3_C | 155 | 237 | 1.5e-23 | 83.2 |
| TkA08G026370 | PF08797 | HIRAN | 163 | 224 | 0.025 | 15.1 |
| TkA08G026370 | PF28557 | DUF8439 | 172 | 213 | 0.37 | 11.8 |
| TkA08G026370 | PF28557 | DUF8439 | 225 | 240 | 0.37 | 11.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.