TkA08G025920 | RubberDandelionOmics

Gene overview

TkA08G025920

Reference: TK1151 Chr: Chr08 Coordinates: 6630891-6634058 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2334 bp · TkA08G025920|TK1151|cDNA

AAAGAATCCAAAACCGTAGATCACAACCTGCCACCGGCGCAAAACAAATCCAAAACCGTCGATCACAACCTGCCTAACAAGAAAAATAATAGTCTAACAGTAGTTAAATCTTAAATGTCTTCACTCATCTTCGTCATGCTGAGTCTAGTTTTGCAGGCTTTGCCATCAAAAACGAATTTCGCAAAGACAATATGCGTATTATATACAGATTTAGATTCAGAATCATATACATTTAGCCGTGTATACACAAACATATACGA...

CDS

Download CDS FASTA

996 bp · TkA08G025920|TK1151|CDS

ATGAAGGAAGATAAGTACTTAATCAACAACCATTTAACATTCACAGTCAAGTTCCATAAAGATCCAGAATTCGAATATGCAAGAATTGTGGGATTTGAAGTTAAACCTTTCAGTGTTAAGCATCAATACGATGGTGAATGGAATGAAGATACGCGCCTCACAACCTGTGATCCCCATGCCAAAAAATTGGTCGCCGGCATTGATCCACCACAAGAAATTGAAGACAGAAACGAGATCATCTTCACCTACGATGTTGAATT...

Protein

Download Protein FASTA

331 aa · TkA08G025920|TK1151|PROTEIN

MKEDKYLINNHLTFTVKFHKDPEFEYARIVGFEVKPFSVKHQYDGEWNEDTRLTTCDPHAKKLVAGIDPPQEIEDRNEIIFTYDVEFQESDVKWASRWDTYLLMSDEQIHWFSIVNSLMIVLFLSGMVAMIMLRTLYRDISNYNQQEDTQDETGWKLLHGDVFRSPVNSDLLCVYVGTGVQFSGMILAAMIFALLGFLSPSNRGGLMTALLLLWVLMAVFGGYAAARLYKSFNGSKWKIITLKTALMFPGLIFTVFFILN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G025920`
TK1151 ID	TkA08G025920
OH-1004 ID	LXL04_018122
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.792 / OH-1004 50.619 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G025920

Location Chr08:6630891-6634058 (-)

Description Similar to TMN8: Transmembrane 9 superfamily member 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10840`	Transmembrane 9 superfamily member 8.	No verified direct reference in this release
`At5g25100`	Transmembrane 9 superfamily member 9.	No verified direct reference in this release
`At2g24170`	Transmembrane 9 superfamily member 10.	No verified direct reference in this release
`At3g13772`	May play a role as effector of cellular copper homeostasis.	Transmembrane nine proteins in yeast and Arabidopsis affect cellular metal contents without changing vacuolar morphology.2010 · DOI: 10.1111/j.1399-3054.2010.01404.x
`At1g55130`	Transmembrane 9 superfamily member 6.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018122 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006811 monoatomic ion transport Biological Process

GO:0006878 intracellular copper ion homeostasis Biological Process

GO:0006882 intracellular zinc ion homeostasis Biological Process

GO:0072657 protein localization to membrane Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

KEGG gene cross-reference

ath:AT1G55130

ath:AT2G24170

ath:AT3G13772

ath:AT5G10840

ath:AT5G25100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.343

Rank 1 · TkA08G025920 · TK1151

Endoplasmic reticulum0.264

Rank 2 · TkA08G025920 · TK1151

Lysosome / Vacuole0.228

Rank 3 · TkA08G025920 · TK1151

Cytoplasm0.181

Rank 4 · TkA08G025920 · TK1151

Cell membrane0.135

Rank 5 · TkA08G025920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02990EMP703-328 aa

PF05425CopD112-134 aa

PF20563DUF6773116-130 aa

PF05425CopD180-261 aa

PF02600DsbB186-229 aa

PF20563DUF6773214-294 aa

PF02600DsbB278-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G025920	`PF02990`	EMP70	3	328	1.3e-126	424.0
TkA08G025920	`PF05425`	CopD	112	134	0.0034	18.5
TkA08G025920	`PF20563`	DUF6773	116	130	4.5	7.8
TkA08G025920	`PF05425`	CopD	180	261	0.0034	18.5
TkA08G025920	`PF02600`	DsbB	186	229	3.4	8.8
TkA08G025920	`PF20563`	DUF6773	214	294	4.5	7.8
TkA08G025920	`PF02600`	DsbB	278	282	3.4	8.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KIB2`	Arabidopsis thaliana	sp\|F4KIB2\|TMN8_ARATH Transmembrane 9 superfamily member 8	73.300%	Swiss-Prot	High
`Q9C5N2`	Arabidopsis thaliana	sp\|Q9C5N2\|TMN9_ARATH Transmembrane 9 superfamily member 9	72.100%	Swiss-Prot	High
`Q8RWW1`	Arabidopsis thaliana	sp\|Q8RWW1\|TMN10_ARATH Transmembrane 9 superfamily member 10	73.000%	Swiss-Prot	High
`Q9LIC2`	Arabidopsis thaliana	sp\|Q9LIC2\|TMN7_ARATH Transmembrane 9 superfamily member 7	69.800%	Swiss-Prot	High
`Q9C720`	Arabidopsis thaliana	sp\|Q9C720\|TMN6_ARATH Transmembrane 9 superfamily member 6	69.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card