TkA08G025910 | RubberDandelionOmics

Gene overview

TkA08G025910

Reference: TK1151 Chr: Chr08 Coordinates: 6627625-6630644 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1986 bp · TkA08G025910|TK1151|cDNA

GCTCTATGTAGGGAAGTTCTTTTCGGTACCAAGGCACAGGCCCGTAATTCCACCCGTCTCCAAGGGCGTTGCCATCATCCTCAACAATTATTATATATACACAGTAGAGACGAGTACAAAAACGACCGCCATTGGAGTAGTAACCTCCTCGATCCACGTCCCTCCCTAATCTCTTTTCATCGACTTTGACAAAATTCGGATCTTCATTATCTGGATATTCATTTTCAATCACTTTCCTGTTCTCGCATGGCTCATGCTCT...

CDS

Download CDS FASTA

813 bp · TkA08G025910|TK1151|CDS

ATGGGTTCTTATCTTGGTGTGGCTGCTGCTTCTGCAAATCCTCCTAAATTTATTCATTTATGTTATAAACCTCCAAATGGATCCATCAAAAAGAAGTTGGCTTTAGTAGGAAAGGGCCTCACTTTCGACAGTGGTGGGTACAATATTAAGACTGGAGTAGGGTGTTTGATAGAGCTCATGAAATTTGATATGGGCGGGTCCGCTGCGGTTTTAGGTGCTGCAAAAGCACTTGGTCAAATTAAACCGCCTGGAGTAGAGGT...

Protein

Download Protein FASTA

270 aa · TkA08G025910|TK1151|PROTEIN

MGSYLGVAAASANPPKFIHLCYKPPNGSIKKKLALVGKGLTFDSGGYNIKTGVGCLIELMKFDMGGSAAVLGAAKALGQIKPPGVEVHFIVAACENMISGTGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALVYACNQGVDKIVDLATLTGACIVALGPSIAGVFTQSDELAKEVVAASEVAGEKLWRMPMEESYWEMMKSGVADMANSGGRQGGSILAALFLKQFVDEKVEWLHIDMAGPVWNDKKKTATGFAVPTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G025910`
TK1151 ID	TkA08G025910
OH-1004 ID	LXL04_018123
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 51.331 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G025910

Location Chr08:6627625-6630644 (-)

Description Similar to LAP1: Leucine aminopeptidase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g24200`	Presumably involved in the processing and regular turnover of intracellular proteins.	No verified direct reference in this release
`At4g30920`	Presumably involved in the processing and regular turnover of intracellular proteins.	Plant leucine aminopeptidases moonlight as molecular chaperones to alleviate stress-induced damage.2012 · DOI: 10.1074/jbc.m111.309500
`At4g30910`	Presumably involved in the processing and regular turnover of intracellular proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0794700`	Presumably involved in the processing and regular turnover of intracellular proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018123 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009611 response to wounding Biological Process

GO:0010150 leaf senescence Biological Process

GO:0034214 protein hexamerization Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0043171 peptide catabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT2G24200

ath:AT4G30910

ath:AT4G30920

dosa:Os02g0794700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.703

Rank 1 · TkA08G025910 · TK1151

Nucleus0.253

Rank 2 · TkA08G025910 · TK1151

Mitochondrion0.184

Rank 3 · TkA08G025910 · TK1151

Cell membrane0.082

Rank 4 · TkA08G025910 · TK1151

Peroxisome0.072

Rank 5 · TkA08G025910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00883Peptidase_M171-261 aa

PF15590Imm27177-202 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G025910	`PF00883`	Peptidase_M17	1	261	7.1e-105	351.4
TkA08G025910	`PF15590`	Imm27	177	202	0.27	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P30184`	Arabidopsis thaliana	sp\|P30184\|AMPL1_ARATH Leucine aminopeptidase 1	86.600%	Swiss-Prot	High
`Q944P7`	Arabidopsis thaliana	sp\|Q944P7\|AMPL2_ARATH Leucine aminopeptidase 2, chloroplastic	86.200%	Swiss-Prot	High
`Q8RX72`	Arabidopsis thaliana	sp\|Q8RX72\|AMPL3_ARATH Leucine aminopeptidase 3, chloroplastic	82.900%	Swiss-Prot	High
`Q6K669`	Oryza sativa subsp. japonica	sp\|Q6K669\|AMPL2_ORYSJ Leucine aminopeptidase 2, chloroplastic	88.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card