TkA08G023180 | RubberDandelionOmics

Gene overview

TkA08G023180

Reference: TK1151 Chr: Chr08 Coordinates: 5873147-5875181 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1658 bp · TkA08G023180|TK1151|cDNA

GTACTTTTTCCCGCTACATTTCCTCTCCCTTCTTTCTAGCCCTCTGCCTGCAGAAATGGCGTCTCAGGAACTGACAGAGTACGAGCGCAAACGCCTGGAAAACATCAAGCGCAACGATGAACTGCTTGCATCTCTCAAAATCCACTCCAAGCTTGCTGATCTGTCTGCCTCATCCAAACGCCGCAGGGAACAGGCTAGATGTTACAGAATTAGTCTACAGAAGAAGAAAGCAAAACCCGAAACCCCAGTTGTAATCCGCA...

CDS

Download CDS FASTA

1392 bp · TkA08G023180|TK1151|CDS

ATGGCGTCTCAGGAACTGACAGAGTACGAGCGCAAACGCCTGGAAAACATCAAGCGCAACGATGAACTGCTTGCATCTCTCAAAATCCACTCCAAGCTTGCTGATCTGTCTGCCTCATCCAAACGCCGCAGGGAACAGGCTAGATGTTACAGAATTAGTCTACAGAAGAAGAAAGCAAAACCCGAAACCCCAGTTGTAATCCGCAAATCTCTAAGAGCCCAAGGAATAAAGCCAGATTTCAGCGAAACACCTAAGGAAAA...

Protein

Download Protein FASTA

463 aa · TkA08G023180|TK1151|PROTEIN

MASQELTEYERKRLENIKRNDELLASLKIHSKLADLSASSKRRREQARCYRISLQKKKAKPETPVVIRKSLRAQGIKPDFSETPKEKTSPKKIMPLKSPRELTPLSMRDVSISSKSDEPLVQKILSVSRPKGATMGVECRVRASIDLDSMELMPENIARVVPGSILSVKFFPSADMRMVAVGSKFGDLGFWNVDSENEDGDGIHMYRPHPASLSSICIHPFAMNKIITCCYHGLIRTLDIQNETFDLTYHSEDGIISMSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G023180`
TK1151 ID	TkA08G023180
OH-1004 ID	LXL04_018156
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G023180`
Location	Chr08:5873147-5875181 (-)
Description	Similar to wdr76: WD repeat-containing protein 76
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018156` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006974 DNA damage response Biological Process GO:2000001 regulation of DNA damage checkpoint Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0034399 nuclear periphery Cellular Component GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference	act:ACLA_085580 ncr:NCU09302 pic:PICST_83842 pno:SNOG_03055 xla:735144 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.935

Rank 1 · TkA08G023180 · TK1151

Cytoplasm0.131

Rank 2 · TkA08G023180 · TK1151

Cell membrane0.019

Rank 3 · TkA08G023180 · TK1151

Mitochondrion0.015

Rank 4 · TkA08G023180 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA08G023180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23756Beta-prop_HPS5163-197 aa

PF21029RMC1_N163-212 aa

PF25175Beta-prop_WDR5164-461 aa

PF24807WD40_CDC20-Fz164-362 aa

PF24796WDR55164-327 aa

PF00400WD40164-183 aa

PF24817WD40_WDHD1_1st164-199 aa

PF23414Beta-prop_EML_2164-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G023180	`PF23756`	Beta-prop_HPS5	163	197	0.0035	17.4
TkA08G023180	`PF21029`	RMC1_N	163	212	0.038	14.8
TkA08G023180	`PF25175`	Beta-prop_WDR5	164	461	7.9e-17	62.2
TkA08G023180	`PF24807`	WD40_CDC20-Fz	164	362	1.7e-15	57.8
TkA08G023180	`PF24796`	WDR55	164	327	1.1e-11	45.0
TkA08G023180	`PF00400`	WD40	164	183	8.6e-11	42.6
TkA08G023180	`PF24817`	WD40_WDHD1_1st	164	199	5.2e-10	39.7
TkA08G023180	`PF23414`	Beta-prop_EML_2	164	195	1.7e-09	38.2
TkA08G023180	`PF25172`	Beta-prop_WDR3_2nd	164	239	2.5e-06	27.6
TkA08G023180	`PF23409`	Beta-prop_EML	164	258	2.8e-06	27.8
TkA08G023180	`PF23381`	Beta-prop_IFT122_1st	165	371	3.2e-18	66.8
TkA08G023180	`PF24814`	WD40_Prp19	165	382	4.3e-17	62.8
TkA08G023180	`PF25174`	Beta-prop_THOC3	173	285	3.7e-17	63.0
TkA08G023180	`PF25047`	Beta-prop_TEP1_2nd	177	241	5.4e-06	26.5
TkA08G023180	`PF25168`	Beta-prop_WDR36-Utp21_2nd	178	369	4.9e-05	23.5
TkA08G023180	`PF13570`	Beta-prop_ACSF4	178	321	0.0018	18.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card