Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2382 bp · TkA08G021140|TK1151|cDNA
TTATTTGTAAGTTTAATCTAGAATATCTGAATATACTTTCATAAATAAAAAAAGTCAAACCTCAATTCTTAGGTGAGATCGAGGAAAAAAAGAGGGTTGACTCCTTCCTCCTTCTTGCCCCTTCCTGGAAAAACCCTAATCCACAAGAAAGACATCTTCATTCTTCCAAATTATCTGTCTGATCAGATTGCAAATCATATTCATACATCAACGATGTCATCGGAGATCGAGGTTGTTGACGAGGTCCAAGAATCCAGAGA...
1836 bp · TkA08G021140|TK1151|CDS
ATGTCATCGGAGATCGAGGTTGTTGACGAGGTCCAAGAATCCAGAGATCGTGATGCTGCTACCGAGAACGGGAATGGAACGACAGAGGGAGGAGTAGATGAAGAGAGTTTAAGAGACGATGTTTATACTGCAGCTGCGTACGGTGATTTGGAGAAGCTGCAGAGATTGGTCGAGTCGGAAGGTTGCTCCGTTTCACAGCCGGATAGCCTCGGGTATTACGCTTTGCAATGGGCCGCCCTCAATAATCGTGCTGCTGCTGC...
Protein
Download Protein FASTA611 aa · TkA08G021140|TK1151|PROTEIN
MSSEIEVVDEVQESRDRDAATENGNGTTEGGVDEESLRDDVYTAAAYGDLEKLQRLVESEGCSVSQPDSLGYYALQWAALNNRAAAAQYIIQHGGDINATDLTGQTALHWSAVRGSIQVAELLLQEGAHINAADMYGYQATHVAAQYGQTALLYHIVTKWNADPDLPDNDGRSPLHWAAYKGFADCIRLLLFLDAYTGRQDKEGCTPLHWGAIRGHLEACTVLVQAGKKEDLMVTDNTGLTAAQLASDKNHRQVAFYLGN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G021140 |
|---|---|
| TK1151 ID | TkA08G021140 |
| OH-1004 ID | LXL04_028102 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 74.000 |
| Protein coverage (%) | TK1151 93.126 / OH-1004 89.776Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G021140 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:5291128-5295472 (+) | |||||||||
| Description | Similar to PAT24: Protein S-acyltransferase 24 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009932 cell tip growth Biological Process GO:0018230 peptidyl-L-cysteine S-palmitoylation Biological Process GO:0018345 protein palmitoylation Biological Process GO:0042953 lipoprotein transport Biological Process GO:0043067 regulation of programmed cell death Biological Process GO:0051386 regulation of neurotrophin TRK receptor signaling pathway Biological Process GO:0070372 regulation of ERK1 and ERK2 cascade Biological Process GO:2000652 regulation of secondary cell wall biogenesis Biological Process GO:2001006 regulation of cellulose biosynthetic process Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005768 endosome Cellular Component GO:0005794 Golgi apparatus Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G14255 ath:AT5G20350 dre:100148543 hsa:23390 rno:366889 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF24521Ank_KRIT142-75 aaPF12796Ank_243-134 aaPF13637Ank_443-91 aaPF13606Ank_343-64 aaPF13857Ank_543-76 aaPF00023Ank44-68 aaPF13857Ank_562-109 aaPF00023Ank71-101 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G021140 | PF24521 | Ank_KRIT1 | 42 | 75 | 0.0074 | 16.7 |
| TkA08G021140 | PF12796 | Ank_2 | 43 | 134 | 6.1e-38 | 130.0 |
| TkA08G021140 | PF13637 | Ank_4 | 43 | 91 | 9.2e-25 | 86.9 |
| TkA08G021140 | PF13606 | Ank_3 | 43 | 64 | 8.6e-23 | 78.4 |
| TkA08G021140 | PF13857 | Ank_5 | 43 | 76 | 3.2e-15 | 56.8 |
| TkA08G021140 | PF00023 | Ank | 44 | 68 | 1.9e-29 | 100.8 |
| TkA08G021140 | PF13857 | Ank_5 | 62 | 109 | 3.2e-15 | 56.8 |
| TkA08G021140 | PF00023 | Ank | 71 | 101 | 1.9e-29 | 100.8 |
| TkA08G021140 | PF13606 | Ank_3 | 71 | 99 | 8.6e-23 | 78.4 |
| TkA08G021140 | PF13637 | Ank_4 | 86 | 124 | 9.2e-25 | 86.9 |
| TkA08G021140 | PF13857 | Ank_5 | 91 | 140 | 3.2e-15 | 56.8 |
| TkA08G021140 | PF00023 | Ank | 104 | 134 | 1.9e-29 | 100.8 |
| TkA08G021140 | PF13606 | Ank_3 | 104 | 132 | 8.6e-23 | 78.4 |
| TkA08G021140 | PF24521 | Ank_KRIT1 | 105 | 195 | 0.0074 | 16.7 |
| TkA08G021140 | PF13637 | Ank_4 | 112 | 151 | 9.2e-25 | 86.9 |
| TkA08G021140 | PF00023 | Ank | 137 | 169 | 1.9e-29 | 100.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.