TkA08G020270 | RubberDandelionOmics

Gene overview

TkA08G020270

Reference: TK1151 Chr: Chr08 Coordinates: 5066024-5070629 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1276 bp · TkA08G020270|TK1151|cDNA

TTTGGAGGGAGGGTTGCAAAATATCTTCAATTTGATACTTTGATTCCCCATTTTTGGAGCTCGCAAATCACACTATACATGTGAAAGTGAAGAGGGGCGAAAAGTGGAGAAATGGATGAAACCGAGTTTCTGAACTCAAGCCAGTCGGAGAAGAAGGGGAGGAACAAGTTTCAATTGTTTAGGTATGAACAACTGCCGGATTATATGAAGGATAATGAGTATATCTTGAATTACTACAGAGCGGAATGGTCTCTCAAACA...

CDS

Download CDS FASTA

1032 bp · TkA08G020270|TK1151|CDS

ATGGATGAAACCGAGTTTCTGAACTCAAGCCAGTCGGAGAAGAAGGGGAGGAACAAGTTTCAATTGTTTAGGTATGAACAACTGCCGGATTATATGAAGGATAATGAGTATATCTTGAATTACTACAGAGCGGAATGGTCTCTCAAACACGCCTTCTTCTCGTTGTTTTTATGCCACAACGAATCTCTTAATGTCTGGACTCACGTGATTGGATTTGTTGCATTTTTTGTGCTCACAATTGCAAACTTGACAAAATTGTA...

Protein

Download Protein FASTA

343 aa · TkA08G020270|TK1151|PROTEIN

MDETEFLNSSQSEKKGRNKFQLFRYEQLPDYMKDNEYILNYYRAEWSLKHAFFSLFLCHNESLNVWTHVIGFVAFFVLTIANLTKLYQVADFLNLSRCHVIGFVAFLVLTIANLTELYQLPDFLNLSKWVFPSNPDTPLPLIKTTRWPLFVFLCGSMFCFVSSSLCHLFSCHSQILNCLLTQLDYVGIAVMIITSFFPPIYYIFECDIVWQYVYLTIISILGVLAISILLSPKRKHGKYRFIRTVIFVAMGLFGIIPTIH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G020270`
TK1151 ID	TkA08G020270
OH-1004 ID	LXL04_018094
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	41.400
Protein coverage (%)	TK1151 94.461 / OH-1004 88.859 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G020270

Location Chr08:5066024-5070629 (-)

Description Similar to HHP2: Heptahelical transmembrane protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20270`	May act as a negative regulator of abscisic acid (ABA)- mediated osmotic stress signaling and function in cross-talk between cold and osmotic signaling.	HHP1 is involved in osmotic stress sensitivity in Arabidopsis.2009 · DOI: 10.1093/jxb/erp039 HHP1, a novel signalling component in the cross-talk between the cold and osmotic signalling pathways in Arabidopsis.2010 · DOI: 10.1093/jxb/erq162
`At4g30850`	May play a role in abiotic stress response.	No verified direct reference in this release
`At4g37680`	May play a role in abiotic stress response.	No verified direct reference in this release
`At2g24150`	May play a role in abiotic stress response.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0643700`	May play a role in abiotic stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018094 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009725 response to hormone Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0016020 membrane Cellular Component

GO:0038023 signaling receptor activity Molecular Function

KEGG gene cross-reference

ath:AT2G24150

ath:AT4G30850

ath:AT4G37680

ath:AT5G20270

dosa:Os06g0643700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.718

Rank 1 · TkA08G020270 · TK1151

Cytoplasm0.132

Rank 2 · TkA08G020270 · TK1151

Endoplasmic reticulum0.115

Rank 3 · TkA08G020270 · TK1151

Lysosome / Vacuole0.071

Rank 4 · TkA08G020270 · TK1151

Mitochondrion0.054

Rank 5 · TkA08G020270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20556DUF676839-114 aa

PF03006HlyIII56-327 aa

PF14084DUF426480-94 aa

PF14084DUF4264110-125 aa

PF20556DUF6768153-169 aa

PF20556DUF6768198-198 aa

PF20556DUF6768237-290 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G020270	`PF20556`	DUF6768	39	114	0.099	13.1
TkA08G020270	`PF03006`	HlyIII	56	327	1.4e-61	208.8
TkA08G020270	`PF14084`	DUF4264	80	94	0.015	15.6
TkA08G020270	`PF14084`	DUF4264	110	125	0.015	15.6
TkA08G020270	`PF20556`	DUF6768	153	169	0.099	13.1
TkA08G020270	`PF20556`	DUF6768	198	198	0.099	13.1
TkA08G020270	`PF20556`	DUF6768	237	290	0.099	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZH9`	Arabidopsis thaliana	sp\|Q93ZH9\|HHP1_ARATH Heptahelical transmembrane protein 1	47.800%	Swiss-Prot	Medium
`Q84N34`	Arabidopsis thaliana	sp\|Q84N34\|HHP2_ARATH Heptahelical transmembrane protein 2	40.200%	Swiss-Prot	Medium
`Q9SZG0`	Arabidopsis thaliana	sp\|Q9SZG0\|HHP4_ARATH Heptahelical transmembrane protein 4	35.900%	Swiss-Prot	Medium
`Q9ZUH8`	Arabidopsis thaliana	sp\|Q9ZUH8\|HHP3_ARATH Heptahelical transmembrane protein 3	39.800%	Swiss-Prot	Medium
`B7F9G7`	Oryza sativa subsp. japonica	sp\|B7F9G7\|ADPO1_ORYSJ Heptahelical transmembrane protein ADIPOR1	44.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card