TkA08G017170 | RubberDandelionOmics

Gene overview

TkA08G017170

Reference: TK1151 Chr: Chr08 Coordinates: 4265792-4269324 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2170 bp · TkA08G017170|TK1151|cDNA

CCCTTATCTTCTTAAACCCTAAAATTTGGTTATCTCGTCTCACTTAACTCACACCTACTCTTTCTGCTCTCGTCTACCATTCCTCTCTCGTTGCAAATTTTCAACTAACTGGTTGAGGATTGTTAGAAGATGGCGTCTATTACTCCCTTATCTTCCATCGGCACTTTTGGGTCAACAAATAAGGCAGTCACAACTTCATTGGAAAATTTGTCTTCATTCTCCTCTATATCTTCAACTCCTCTTGCACACAGAAGGCAGAA...

CDS

Download CDS FASTA

1812 bp · TkA08G017170|TK1151|CDS

ATGGCGTCTATTACTCCCTTATCTTCCATCGGCACTTTTGGGTCAACAAATAAGGCAGTCACAACTTCATTGGAAAATTTGTCTTCATTCTCCTCTATATCTTCAACTCCTCTTGCACACAGAAGGCAGAATGTAGTTTTGCACAAAAGAAGTTCCCTTAAGGTTAACGCCATGGCCAAAGATATATACTTAAACAAAGATGGTTCTGCTATCAAGAAGCTACAGGCTGGTGTCAACAAGCTTGCAGATCTAGTAGGAGT...

Protein

Download Protein FASTA

603 aa · TkA08G017170|TK1151|PROTEIN

MASITPLSSIGTFGSTNKAVTTSLENLSSFSSISSTPLAHRRQNVVLHKRSSLKVNAMAKDIYLNKDGSAIKKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAKEVELEDPVENIGAKLVRQAASKTNDLAGDGTTTSVVLAQGLITEGVKVVAAGANPIQITRGIEKTTKALVEELKRMSKEVTDSELADVAAVSAGNNEEVGQMIAEAMSKVGRKGVVTLEEGKSAENHLYVVEGMQFDRGYLSPY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G017170`
TK1151 ID	TkA08G017170
OH-1004 ID	LXL04_002116
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G017170

Location Chr08:4265792-4269324 (-)

Description Similar to RuBisCO large subunit-binding protein subunit beta, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13470`	Involved in protein assisted folding.	No verified direct reference in this release
`At1g55490`	Binds RuBisCO small and large subunits and is implicated in the assembly of the enzyme oligomer.	Deletion of a chaperonin 60 beta gene leads to cell death in the Arabidopsis lesion initiation 1 mutant.2003 · DOI: 10.1093/pcp/pcg031
`At5g56500`	Involved in protein assisted folding.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002116 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0009409 response to cold Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0042026 protein refolding Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0010319 stromule Cellular Component

KEGG gene cross-reference

ath:AT1G55490

ath:AT3G13470

ath:AT5G56500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.968

Rank 1 · TkA08G017170 · TK1151

Mitochondrion0.056

Rank 2 · TkA08G017170 · TK1151

Cytoplasm0.025

Rank 3 · TkA08G017170 · TK1151

Peroxisome0.015

Rank 4 · TkA08G017170 · TK1151

Nucleus0.013

Rank 5 · TkA08G017170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00118Cpn60_TCP181-583 aa

PF25459AIM3_BBC1_C118-152 aa

PF21835YIEGIA_cap174-190 aa

PF15104CFAP141181-196 aa

PF21835YIEGIA_cap212-237 aa

PF21835YIEGIA_cap292-324 aa

PF25459AIM3_BBC1_C370-412 aa

PF15104CFAP141395-423 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G017170	`PF00118`	Cpn60_TCP1	81	583	1e-85	289.0
TkA08G017170	`PF25459`	AIM3_BBC1_C	118	152	0.11	12.9
TkA08G017170	`PF21835`	YIEGIA_cap	174	190	0.15	12.5
TkA08G017170	`PF15104`	CFAP141	181	196	0.27	12.0
TkA08G017170	`PF21835`	YIEGIA_cap	212	237	0.15	12.5
TkA08G017170	`PF21835`	YIEGIA_cap	292	324	0.15	12.5
TkA08G017170	`PF25459`	AIM3_BBC1_C	370	412	0.11	12.9
TkA08G017170	`PF15104`	CFAP141	395	423	0.27	12.0
TkA08G017170	`PF21835`	YIEGIA_cap	429	469	0.15	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJE4`	Arabidopsis thaliana	sp\|Q9LJE4\|CPNB2_ARATH Chaperonin 60 subunit beta 2, chloroplastic	86.000%	Swiss-Prot	High
`P21240`	Arabidopsis thaliana	sp\|P21240\|CPNB1_ARATH Chaperonin 60 subunit beta 1, chloroplastic	84.300%	Swiss-Prot	High
`C0Z361`	Arabidopsis thaliana	sp\|C0Z361\|CPNB3_ARATH Chaperonin 60 subunit beta 3, chloroplastic	85.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card