TkA08G017120 | RubberDandelionOmics

Gene overview

TkA08G017120

Reference: TK1151 Chr: Chr08 Coordinates: 4251110-4253988 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1725 bp · TkA08G017120|TK1151|cDNA

ATGGCTTCATCTTCATCAAATCAAAACTGCTTGGTAGTGGAGGTGTATTTTAATGGCACATTTACATGGAAGCCACTTGCGTACTTCGATCCAGACCGTAAGATTGTGCGAGACGTTGATTTCAAGGGGTTTAGCCACTCGGACTTCATCTCATTCCTGGAGAAGCTCACTAGAACAAAATGTAACGACGTATTCTGTTGCCTTCCTCAACATTCGTTGTGTGAGGGGATTCATGCCATTCAAAACGACGGTGATTATAA...

CDS

Download CDS FASTA

1725 bp · TkA08G017120|TK1151|CDS

ATGGCTTCATCTTCATCAAATCAAAACTGCTTGGTAGTGGAGGTGTATTTTAATGGCACATTTACATGGAAGCCACTTGCGTACTTCGATCCAGACCGTAAGATTGTGCGAGACGTTGATTTCAAGGGGTTTAGCCACTCGGACTTCATCTCATTCCTGGAGAAGCTCACTAGAACAAAATGTAACGACGTATTCTGTTGCCTTCCTCAACATTCGTTGTGTGAGGGGATTCATGCCATTCAAAACGACGGTGATTATAA...

Protein

Download Protein FASTA

574 aa · TkA08G017120|TK1151|PROTEIN

MASSSSNQNCLVVEVYFNGTFTWKPLAYFDPDRKIVRDVDFKGFSHSDFISFLEKLTRTKCNDVFCCLPQHSLCEGIHAIQNDGDYKEFLDMGYGNGNRIDVYVDHYNEPLFDWIEAEEDANNNIYPLAWAVVCVESKDTWKWFIDLLMDDINGGVGAGITLISDGHKGLLEAVKERCPEAEHRQCARHILANFRKRFSGEHFRKLFWRAVKSSTMESFRATMEEITSIDSHAYDYLIERDPTSWSKAFFPEGRDCDAME...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G017120`
TK1151 ID	TkA08G017120
OH-1004 ID	LXL04_011904
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	40.500
Protein coverage (%)	TK1151 99.129 / OH-1004 99.754 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G017120`
Location	Chr08:4251110-4253988 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011904` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.920

Rank 1 · TkA08G017120 · TK1151

Cytoplasm0.151

Rank 2 · TkA08G017120 · TK1151

Cell membrane0.030

Rank 3 · TkA08G017120 · TK1151

Endoplasmic reticulum0.022

Rank 4 · TkA08G017120 · TK1151

Mitochondrion0.014

Rank 5 · TkA08G017120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26130PB1-like12-106 aa

PF10551MULE107-193 aa

PF00872Transposase_mut132-245 aa

PF26130PB1-like304-328 aa

PF15288zf-CCHC_6346-361 aa

PF04434SWIM347-376 aa

PF28211GlpR453-559 aa

PF15288zf-CCHC_6458-488 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G017120	`PF26130`	PB1-like	12	106	0.00018	22.5
TkA08G017120	`PF10551`	MULE	107	193	9.8e-11	42.6
TkA08G017120	`PF00872`	Transposase_mut	132	245	8.8e-08	32.1
TkA08G017120	`PF26130`	PB1-like	304	328	0.00018	22.5
TkA08G017120	`PF15288`	zf-CCHC_6	346	361	0.029	15.0
TkA08G017120	`PF04434`	SWIM	347	376	1.7e-07	31.3
TkA08G017120	`PF28211`	GlpR	453	559	1.3	9.7
TkA08G017120	`PF15288`	zf-CCHC_6	458	488	0.029	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card