Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2481 bp · TkA08G016930|TK1151|cDNA
GCCTTTCGCAGCGTGTTGCCTCGATGGCTTCGCTTCAAACCAACCACCAAACCCCCCTTCGTCTTCTGTATCGCCATTTTCCCCCTTTCTCCTTTAATGGCCTCCCGATTTGTATTTCAATCCCCCAATTTTCACCCATACCACCTGGAATTAACTGGATCAGAAGAAAGTGCAAAATCCATAGCTTTCTCATCCCATGGGATCATATTCAAAAACTCCATTCCAACATCTCAAAATATCTCACTACAACATCAATCTTC...
2202 bp · TkA08G016930|TK1151|CDS
GCCTTTCGCAGCGTGTTGCCTCGATGGCTTCGCTTCAAACCAACCACCAAACCCCCCTTCGTCTTCTGTATCGCCATTTTCCCCCTTTCTCCTTTAATGGCCTCCCGATTTGTATTTCAATCCCCCAATTTTCACCCATACCACCTGGAATTAACTGGATCAGAAGAAAGTGCAAAATCCATAGCTTTCTCATCCCATGGGATCATATTCAAAAACTCCATTCCAACATCTCAAAATATCTCACTACAACATCAATCTTC...
Protein
Download Protein FASTA733 aa · TkA08G016930|TK1151|PROTEIN
AFRSVLPRWLRFKPTTKPPFVFCIAIFPLSPLMASRFVFQSPNFHPYHLELTGSEESAKSIAFSSHGIIFKNSIPTSQNISLQHQSSSRSLSSIPSSLNNNIITNDNPSMTTTTKDDSELNRVNHLVRILHESARSFSLAIQNLQLARSGPELSNAWNGVDVHAWHKRTAYQVAVYALLKAAIEVELFLSQKRCNSPVSEILSTKTLFLGDFVESQLNAKHPKLVQWFRTVELPHTAGSFIPLFKNWSLEYAGSGVAGVI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G016930 |
|---|---|
| TK1151 ID | TkA08G016930 |
| OH-1004 ID | LXL04_004798 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 27.700 |
| Protein coverage (%) | TK1151 85.402 / OH-1004 89.491Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G016930 |
|---|---|
| Location | Chr08:4192391-4196747 (-) |
| Description | Similar to Letm1: Mitochondrial proton/calcium exchanger protein |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006851 mitochondrial calcium ion transmembrane transport Biological Process GO:0007005 mitochondrion organization Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:0071805 potassium ion transmembrane transport Biological Process GO:1902600 proton transmembrane transport Biological Process GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0031966 mitochondrial membrane Cellular Component GO:0005432 calcium:sodium antiporter activity Molecular Function GO:0005509 calcium ion binding Molecular Function GO:0015386 potassium:proton antiporter activity Molecular Function GO:0022857 transmembrane transporter activity Molecular Function |
| KEGG gene cross-reference | dme:Dmel_CG4589 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07766LETM1_RBD197-221 aaPF07766LETM1_RBD637-717 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G016930 | PF07766 | LETM1_RBD | 197 | 221 | 4.1e-05 | 24.0 |
| TkA08G016930 | PF07766 | LETM1_RBD | 637 | 717 | 4.1e-05 | 24.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.