TkA08G016320 | RubberDandelionOmics

Gene overview

TkA08G016320

Reference: TK1151 Chr: Chr08 Coordinates: 3989240-3992183 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1236 bp · TkA08G016320|TK1151|cDNA

GTTGTATGCTGCTTCTGCCATGAAACTCTGGGAAGAAACTTCACCAAAAACCACTGAAAATCCCACTTCCCATCTCTCGATCACCATATTTGAAGATGTCGGTGTTCTTCAAGAGTCTAAGTAAATCTGCATCCATCACATTCTCTCATGCATTTCGAGGCAAATCGCAATCAAATTCAACCAATTTCCCAATTCCATTTGGAGCAATCGCCGCTATATCTGGTGGAATATCGTATTTTTACTACTTTTCTGAACCACAT...

CDS

Download CDS FASTA

984 bp · TkA08G016320|TK1151|CDS

ATGTCGGTGTTCTTCAAGAGTCTAAGTAAATCTGCATCCATCACATTCTCTCATGCATTTCGAGGCAAATCGCAATCAAATTCAACCAATTTCCCAATTCCATTTGGAGCAATCGCCGCTATATCTGGTGGAATATCGTATTTTTACTACTTTTCTGAACCACATTTGGCCCATTTAGATCGACTCAACGAGGAGACAGGTCCAAAAGCCGCTCTCGATTCCAAAAAATGGCAAGCGTTTAAGTTACAAGAGAAGGCAAC...

Protein

Download Protein FASTA

327 aa · TkA08G016320|TK1151|PROTEIN

MSVFFKSLSKSASITFSHAFRGKSQSNSTNFPIPFGAIAAISGGISYFYYFSEPHLAHLDRLNEETGPKAALDSKKWQAFKLQEKATVSHNTHVYRFSFDPNLKLGLGVASCLITRVPSGQDANGKTKYVIRPYTPISDPDSKGYFDLMIKVYPEGNMSQHFAKLEPGDVVEVKGPVEKVGYTPNMKKHIGMIAGGSGITPMLQVIEAILKNPDDNTKVSLVYANVSPDDILLKKRLDMLAATHPNLKVFYTVDNPSKYW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G016320`
TK1151 ID	TkA08G016320
OH-1004 ID	LXL04_018272
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G016320

Location Chr08:3989240-3992183 (+)

Description Similar to CBR2: NADH-cytochrome b5 reductase-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20080`	Desaturation and elongation of fatty acids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018272 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006696 ergosterol biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005758 mitochondrial intermembrane space Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009536 plastid Cellular Component

GO:0004128 cytochrome-b5 reductase activity, acting on NAD(P)H Molecular Function

GO:0005507 copper ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0090524 cytochrome-b5 reductase activity, acting on NADH Molecular Function

KEGG gene cross-reference

act:ACLA_030130

ath:AT5G20080

ddi:DDB_G0285399

mgr:MGG_03708

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.946

Rank 1 · TkA08G016320 · TK1151

Cytoplasm0.072

Rank 2 · TkA08G016320 · TK1151

Nucleus0.042

Rank 3 · TkA08G016320 · TK1151

Cell membrane0.026

Rank 4 · TkA08G016320 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA08G016320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00970FAD_binding_680-182 aa

PF01336tRNA_anti-codon144-179 aa

PF2673303009_C184-252 aa

PF08030NAD_binding_6189-254 aa

PF00175NAD_binding_1192-297 aa

PF08030NAD_binding_6279-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G016320	`PF00970`	FAD_binding_6	80	182	5.7e-25	88.3
TkA08G016320	`PF01336`	tRNA_anti-codon	144	179	0.23	12.1
TkA08G016320	`PF26733`	03009_C	184	252	0.066	13.8
TkA08G016320	`PF08030`	NAD_binding_6	189	254	3.8e-06	27.8
TkA08G016320	`PF00175`	NAD_binding_1	192	297	3.7e-30	105.5
TkA08G016320	`PF08030`	NAD_binding_6	279	297	3.8e-06	27.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P83291`	Arabidopsis thaliana	sp\|P83291\|NB5R2_ARATH NADH-cytochrome b5 reductase-like protein	71.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card