TkA08G016070 | RubberDandelionOmics

Gene overview

TkA08G016070

Reference: TK1151 Chr: Chr08 Coordinates: 3926342-3927943 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

691 bp · TkA08G016070|TK1151|cDNA

ATAAACCATCTCTCTCAAGGTTTTTAACCTACAACAAGAGAAAATGAGTAGTGGAGACTGGATGTGTGGTGCATGCCAACATATAAATTTCAAGAAACGCGATGCTTGTCAAAGGTGCCAGTGTCCTAAATTCGCGACACCTTCGGAAATGTCGGGTTATGGGATTGACAGAACGGAGGTATTAGCAGGTGATTGGTATTGCTCGACGTTTAATTGTGGGGCCCACAACTACGCTAGTCGAACTGTGTGTTATAGATGTG...

CDS

Download CDS FASTA

402 bp · TkA08G016070|TK1151|CDS

ATGAGTAGTGGAGACTGGATGTGTGGTGCATGCCAACATATAAATTTCAAGAAACGCGATGCTTGTCAAAGGTGCCAGTGTCCTAAATTCGCGACACCTTCGGAAATGTCGGGTTATGGGATTGACAGAACGGAGGTATTAGCAGGTGATTGGTATTGCTCGACGTTTAATTGTGGGGCCCACAACTACGCTAGTCGAACTGTGTGTTATAGATGTGGTGTACTTAAAGATTACACGACGGCTGCCATGATGGCAGCTTC...

Protein

Download Protein FASTA

133 aa · TkA08G016070|TK1151|PROTEIN

MSSGDWMCGACQHINFKKRDACQRCQCPKFATPSEMSGYGIDRTEVLAGDWYCSTFNCGAHNYASRTVCYRCGVLKDYTTAAMMAASTAGYYAHDPNALPGWKSGDWVCNRLGCGVHNYASRMECYKCKTSRE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G016070`
TK1151 ID	TkA08G016070
OH-1004 ID	LXL04_018268
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 57.082 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G016070`
Location	Chr08:3926342-3927943 (-)
Description	Similar to ZRANB2: Zinc finger Ran-binding domain-containing protein 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018268` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006396 RNA processing Biological Process GO:0031445 regulation of heterochromatin formation Biological Process GO:0071502 cellular response to temperature stimulus Biological Process GO:0005634 nucleus Cellular Component GO:0005694 chromosome Cellular Component GO:0005737 cytoplasm Cellular Component GO:0010494 cytoplasmic stress granule Cellular Component GO:0140453 protein aggregate center Cellular Component GO:0000175 3'-5'-RNA exonuclease activity Molecular Function GO:0001530 lipopolysaccharide binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003729 mRNA binding Molecular Function
KEGG gene cross-reference	afm:AFUA_5G02160 gga:424717 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.590

Rank 1 · TkA08G016070 · TK1151

Nucleus0.576

Rank 2 · TkA08G016070 · TK1151

Cell membrane0.045

Rank 3 · TkA08G016070 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA08G016070 · TK1151

Mitochondrion0.036

Rank 5 · TkA08G016070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00641Zn_ribbon_RanBP3-30 aa

PF00641Zn_ribbon_RanBP48-73 aa

PF00641Zn_ribbon_RanBP103-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G016070	`PF00641`	Zn_ribbon_RanBP	3	30	6.6e-15	54.8
TkA08G016070	`PF00641`	Zn_ribbon_RanBP	48	73	6.6e-15	54.8
TkA08G016070	`PF00641`	Zn_ribbon_RanBP	103	133	6.6e-15	54.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card