RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G015810
Reference: TK1151 Chr: Chr08 Coordinates: 3850913-3853010 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1438 bp · TkA08G015810|TK1151|cDNA

CTTAAATTGACGTTTATTATAAAACATAATTTGGTAACAATAAAAGGTTGAAAGAGAGTCAAATGTCGTTCAGTCGTTATGCCCTAATCGAAGATTCCATAGTTCCCTATGTCGGTCGCGCTGCCTCTCTGCTAAACTTCACACGCCATACCCATATGTCGACCACCGCTAACGGTTCCGCCGCCGAAAGGCGTACAGCCACCAGCAATGGCCGCAGTCCGGTGGACAAAGAAGTCGACTTCGCCAACTACTTCTGCACA...

CDS

Download CDS FASTA

1236 bp · TkA08G015810|TK1151|CDS

ATGTCGTTCAGTCGTTATGCCCTAATCGAAGATTCCATAGTTCCCTATGTCGGTCGCGCTGCCTCTCTGCTAAACTTCACACGCCATACCCATATGTCGACCACCGCTAACGGTTCCGCCGCCGAAAGGCGTACAGCCACCAGCAATGGCCGCAGTCCGGTGGACAAAGAAGTCGACTTCGCCAACTACTTCTGCACATACGCTTTTCTCTTCCACCAAAAAGAGATGCTCTCCGATCGAGTTCGAATGGACGCTTACTA...

Protein

Download Protein FASTA

411 aa · TkA08G015810|TK1151|PROTEIN

MSFSRYALIEDSIVPYVGRAASLLNFTRHTHMSTTANGSAAERRTATSNGRSPVDKEVDFANYFCTYAFLFHQKEMLSDRVRMDAYYNSVFQNKHHFVGKTVLDVGTGSGILAIWSAQAGARKVYAVEATKMAVHARELVKSNNLQDVIEVIEGSIEDITLPEKVDVIISEWMGYFLLRESMFDSVIYARDRWLKPNGVMYPSHARMYLAPIRSGLSDHKMRDYEGAMDDWHGFLKETEACYGVNMNVLTKPFSEEQKKY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G015810
TK1151 IDTkA08G015810
OH-1004 IDLXL04_018263
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G015810
LocationChr08:3850913-3853010 (-)
DescriptionSimilar to PRMT10: Protein arginine N-methyltransferase PRMT10
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g04870 Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.
Crystal structure of the plant epigenetic protein arginine methyltransferase 10.2011 · DOI: 10.1016/j.jmb.2011.09.040

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0142800 Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins. No verified direct reference in this release
UniProt: A2Y953 Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins. No verified direct reference in this release
UniProt: A2XYY8 Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and asymmetrical dimethylarginine (aDMA). No verified direct reference in this release
Os04g0677066 Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and asymmetrical dimethylarginine (aDMA). No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_018263 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006338 chromatin remodeling Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0010228 vegetative to reproductive phase transition of meristem Biological Process
GO:0019919 peptidyl-arginine methylation, to asymmetrical-dimethyl arginine Biological Process
GO:0032259 methylation Biological Process
GO:0005634 nucleus Cellular Component
GO:0016274 protein-arginine N-methyltransferase activity Molecular Function
GO:0035241 protein-arginine omega-N monomethyltransferase activity Molecular Function
GO:0035242 protein-arginine omega-N asymmetric methyltransferase activity Molecular Function
GO:0042054 histone methyltransferase activity Molecular Function
GO:0044020 histone H4R3 methyltransferase activity Molecular Function
KEGG gene cross-reference
ath:AT1G04870
dosa:Os06g0142800
osa:9268644
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.597
Rank 1 · TkA08G015810 · TK1151
Nucleus0.453
Rank 2 · TkA08G015810 · TK1151
Mitochondrion0.093
Rank 3 · TkA08G015810 · TK1151
Cell membrane0.043
Rank 4 · TkA08G015810 · TK1151
Endoplasmic reticulum0.040
Rank 5 · TkA08G015810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03848TehB72-193 aa
PF03602Cons_hypoth9579-147 aa
PF08003Methyltransf_984-192 aa
PF02353CMAS91-200 aa
PF02527GidB94-170 aa
PF13489Methyltransf_2396-169 aa
PF05175MTS98-170 aa
PF06325PrmA99-171 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G015810PF03848TehB721930.002118.2
TkA08G015810PF03602Cons_hypoth95791470.004817.3
TkA08G015810PF08003Methyltransf_9841920.001917.9
TkA08G015810PF02353CMAS912000.005916.7
TkA08G015810PF02527GidB941700.03814.0
TkA08G015810PF13489Methyltransf_23961690.0001422.3
TkA08G015810PF05175MTS981701.1e-0732.3
TkA08G015810PF06325PrmA991717.4e-1349.4
TkA08G015810PF13847Methyltransf_31992066.8e-0833.1
TkA08G015810PF02475TRM5-TYW2_MTfase991731e-0526.3
TkA08G015810PF12847Methyltransf_18991760.0001422.7
TkA08G015810PF01135PCMT991490.05813.9
TkA08G015810PF05185PRMT51011793.3e-0524.5
TkA08G015810PF13649Methyltransf_251021983.2e-1041.3
TkA08G015810PF08241Methyltransf_111032001.8e-0938.8
TkA08G015810PF08242Methyltransf_121031990.0007920.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9MAT5Arabidopsis thalianasp|Q9MAT5|ANM10_ARATH Protein arginine N-methyltransferase PRMT1065.000%Swiss-ProtHigh
Q9SNQ2Oryza sativa subsp. japonicasp|Q9SNQ2|ANM10_ORYSJ Protein arginine N-methyltransferase PRMT1063.200%Swiss-ProtHigh
A2Y953Oryza sativa subsp. indicasp|A2Y953|ANM10_ORYSI Protein arginine N-methyltransferase PRMT1064.900%Swiss-ProtHigh
A2XYY8Oryza sativa subsp. indicasp|A2XYY8|ANM61_ORYSI Probable protein arginine N-methyltransferase 6.136.400%Swiss-ProtMedium
Q7XKC0Oryza sativa subsp. japonicasp|Q7XKC0|ANM61_ORYSJ Probable protein arginine N-methyltransferase 6.136.400%Swiss-ProtMedium

JBrowse

View in Genome Browser