TkA08G003670 | RubberDandelionOmics

Gene overview

TkA08G003670

Reference: TK1151 Chr: Chr08 Coordinates: 946078-946990 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

732 bp · TkA08G003670|TK1151|cDNA

CAGATCTTCAACTGGGTTCACCGTCGATTTAATCACAAAGATGAAGTTGGCCAAGATGGCACAAATGGAGAGGCTATAAGTGGAAATAGGAAGGACAAGCTAGCGTTGATTGAAAATGCAGCCCTCGATAGTATGTTTGATGGTTGGAAAGAAGGTATACTTGCTATTGGAACATTAGGATTTGATCCTGCATTATTCAAAGGTTTAGAGACAAACGATGACACACACTTATGTGAAATTAGTAGTAAAGAATTATTTGT...

CDS

Download CDS FASTA

732 bp · TkA08G003670|TK1151|CDS

CAGATCTTCAACTGGGTTCACCGTCGATTTAATCACAAAGATGAAGTTGGCCAAGATGGCACAAATGGAGAGGCTATAAGTGGAAATAGGAAGGACAAGCTAGCGTTGATTGAAAATGCAGCCCTCGATAGTATGTTTGATGGTTGGAAAGAAGGTATACTTGCTATTGGAACATTAGGATTTGATCCTGCATTATTCAAAGGTTTAGAGACAAACGATGACACACACTTATGTGAAATTAGTAGTAAAGAATTATTTGT...

Protein

Download Protein FASTA

243 aa · TkA08G003670|TK1151|PROTEIN

QIFNWVHRRFNHKDEVGQDGTNGEAISGNRKDKLALIENAALDSMFDGWKEGILAIGTLGFDPALFKGLETNDDTHLCEISSKELFVSDSADKEEGEIEFPMVLRAVKHGFLHDEHQQCDDEVLKPTDDHEDDVEDLARKDTNTLKKEKNTGERITLADLFWADSKKNMLKNKMLGDEPDHAKVHNKNRDSNDDRVPLISNKKKLTRDITPHTIKKINGMMRKMLKKKIHPDVVRVPRSVGTA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G003670`
TK1151 ID	TkA08G003670
OH-1004 ID	LXL04_010823
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	42.000
Protein coverage (%)	TK1151 96.296 / OH-1004 93.548 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G003670

Location Chr08:946078-946990 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46640`	Involved in the regulation of inflorescence branch growth angle.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010823 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001763 morphogenesis of a branching structure Biological Process

GO:0060771 phyllotactic patterning Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G46640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.464

Rank 1 · TkA08G003670 · TK1151

Nucleus0.361

Rank 2 · TkA08G003670 · TK1151

Cytoplasm0.310

Rank 3 · TkA08G003670 · TK1151

Endoplasmic reticulum0.082

Rank 4 · TkA08G003670 · TK1151

Plastid0.038

Rank 5 · TkA08G003670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28425LAZY_C45-67 aa

PF27829Ctm168-190 aa

PF10779XhlA127-155 aa

PF10779XhlA212-220 aa

PF28425LAZY_C215-232 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G003670	`PF28425`	LAZY_C	45	67	2.6	8.4
TkA08G003670	`PF27829`	Ctm1	68	190	0.017	14.4
TkA08G003670	`PF10779`	XhlA	127	155	0.92	10.5
TkA08G003670	`PF10779`	XhlA	212	220	0.92	10.5
TkA08G003670	`PF28425`	LAZY_C	215	232	2.6	8.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IJ79`	Arabidopsis thaliana	sp\|F4IJ79\|TAC1_ARATH Protein TILLER ANGLE CONTROL 1	27.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card