RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G445230
Reference: TK1151 Chr: Chr07 Coordinates: 112947966-112961802 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2013 bp · TkA07G445230|TK1151|cDNA

GGTGGGGCAGTTTTTTGACCTGACAAAGTTACTTGGTTCGATTCACGTGAGGAAGGATGTAGATTGCTGCCTTTGAGATATAGACCCGAGTGGAAACATCGAGACCAGAAGACCACTCAGATCTGCGACCACAAAAGCTTCGCCAAAACCTAATTCAGTGTACCATTTTTGCTCGTACAGTACATTTTGGTGATACCAAATGGCAGAGGTGGATGTTCAAAATCCTCTTCTTGGTGATACAACTTGCGGTTCTTTACTGG...

CDS

Download CDS FASTA

1737 bp · TkA07G445230|TK1151|CDS

ATGGCAGAGGTGGATGTTCAAAATCCTCTTCTTGGTGATACAACTTGCGGTTCTTTACTGGATCAGTTGCAGAAAATTTGGGATGAAGTTGGTGAAAATGACGATGAAAGGGATAAGATGCTTCTTCAGTTGGAACAAGAGTGTTTGGATGTATACAAGAGGAAAGTTGACCAAGCTACAAAGTCAAGGGCACACCTTCTTCAGACACTAGCAGATGCTAAACTTGAACTCACTACTCTTCTCGCATCACTTGGAGAGAA...

Protein

Download Protein FASTA

578 aa · TkA07G445230|TK1151|PROTEIN

MAEVDVQNPLLGDTTCGSLLDQLQKIWDEVGENDDERDKMLLQLEQECLDVYKRKVDQATKSRAHLLQTLADAKLELTTLLASLGEKTFVGMPDKTSGTIKEQLAAIAPALEQLWKQKEERIKELIDVQSQIQKICGEIAGSNQQSGSPTVDESDLSFKKLSEFHDQLKDLQKEKSDRLHKVLELVSTVHDLCAVLGIDFYTTVTEVHPSLNDATQDQSKSISNDTLARLAKTVLALEEDKKQRLNKLQELASQLIDLWN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G445230
TK1151 IDTkA07G445230
OH-1004 IDLXL04_031009
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)97.400
Protein coverage (%)TK1151 99.827 / OH-1004 48.229
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G445230
LocationChr07:112947966-112961802 (+)
DescriptionSimilar to MAP65-1: 65-kDa microtubule-associated protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g55230 Microtubule-associated protein that bundle and stabilize adjacent microtubules (MT) of the cell cortex.
In vivo dynamics and differential microtubule-binding activities of MAP65 proteins.2004 · DOI: 10.1104/pp.104.051623
Two microtubule-associated proteins of the Arabidopsis MAP65 family function differently on microtubules.2005 · DOI: 10.1104/pp.104.052456
Dynamic interaction of NtMAP65-1a with microtubules in vivo.2005 · DOI: 10.1242/jcs.02433
Modulated targeting of GFP-AtMAP65-1 to central spindle microtubules during division.2005 · DOI: 10.1111/j.1365-313x.2005.02464.x
Control of the AtMAP65-1 interaction with microtubules through the cell cycle.2006 · DOI: 10.1242/jcs.03051
AtMAP65-1 binds to tubulin dimers to promote tubulin assembly.2007 · DOI: 10.5483/bmbrep.2007.40.2.218
Two microtubule-associated proteins of Arabidopsis MAP65s promote antiparallel microtubule bundling.2008 · DOI: 10.1091/mbc.e08-04-0341
Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746
At4g26760 Microtubule-associated protein that stabilize microtubules (MT).
Arabidopsis microtubule-associated protein AtMAP65-2 acts as a microtubule stabilizer.2009 · DOI: 10.1007/s11103-008-9426-1
At5g51600 Microtubule-associated protein that plays a critical role in organizing the mitotic microtubule array during both early and late mitosis in all plant organs.
The plant microtubule-associated protein AtMAP65-3/PLE is essential for cytokinetic phragmoplast function.2004 · DOI: 10.1016/j.cub.2004.02.032
MAP65-3 microtubule-associated protein is essential for nematode-induced giant cell ontogenesis in Arabidopsis.2008 · DOI: 10.1105/tpc.107.057422
At1g14690 65-kDa microtubule-associated protein 7. No verified direct reference in this release
At2g01910 Microtubule-associated protein that mediates the formation of a mesh-like stable and dense network formed by individual microtubules (MT).
Two microtubule-associated proteins of the Arabidopsis MAP65 family function differently on microtubules.2005 · DOI: 10.1104/pp.104.052456

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031009 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000226 microtubule cytoskeleton organization Biological Process
GO:0000911 cytokinesis by cell plate formation Biological Process
GO:0001578 microtubule bundle formation Biological Process
GO:0007020 microtubule nucleation Biological Process
GO:0031116 positive regulation of microtubule polymerization Biological Process
GO:0043622 cortical microtubule organization Biological Process
GO:0046785 microtubule polymerization Biological Process
GO:0048528 post-embryonic root development Biological Process
GO:0051301 cell division Biological Process
GO:0000922 spindle pole Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference
ath:AT1G14690
ath:AT4G26760
ath:AT5G55230
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.716
Rank 1 · TkA07G445230 · TK1151
Nucleus0.316
Rank 2 · TkA07G445230 · TK1151
Cell membrane0.058
Rank 3 · TkA07G445230 · TK1151
Mitochondrion0.047
Rank 4 · TkA07G445230 · TK1151
Golgi apparatus0.043
Rank 5 · TkA07G445230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03999MAP65_ASE118-507 aa
PF23216WHD_CYT441-55 aa
PF23005DUF7032100-135 aa
PF23289Spectrin_5158-193 aa
PF12731Mating_N159-190 aa
PF23216WHD_CYT4159-190 aa
PF23005DUF7032159-189 aa
PF29896PPFR1_M168-248 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G445230PF03999MAP65_ASE1185078.2e-83279.4
TkA07G445230PF23216WHD_CYT441551.79.6
TkA07G445230PF23005DUF70321001352.78.5
TkA07G445230PF23289Spectrin_51581930.4511.4
TkA07G445230PF12731Mating_N1591900.3111.9
TkA07G445230PF23216WHD_CYT41591901.79.6
TkA07G445230PF23005DUF70321591892.78.5
TkA07G445230PF29896PPFR1_M1682480.1113.7
TkA07G445230PF12731Mating_N2002480.3111.9
TkA07G445230PF23005DUF70322042362.78.5
TkA07G445230PF23216WHD_CYT42162581.79.6
TkA07G445230PF23005DUF70322462862.78.5
TkA07G445230PF23289Spectrin_52542860.4511.4
TkA07G445230PF23289Spectrin_53203300.4511.4
TkA07G445230PF23289Spectrin_53803940.4511.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FLP0Arabidopsis thalianasp|Q9FLP0|MA651_ARATH 65-kDa microtubule-associated protein 174.100%Swiss-ProtHigh
Q8LEG3Arabidopsis thalianasp|Q8LEG3|MA652_ARATH 65-kDa microtubule-associated protein 269.300%Swiss-ProtHigh
Q9FHM4Arabidopsis thalianasp|Q9FHM4|MA653_ARATH 65-kDa microtubule-associated protein 349.400%Swiss-ProtMedium
Q8L836Arabidopsis thalianasp|Q8L836|MA657_ARATH 65-kDa microtubule-associated protein 747.100%Swiss-ProtMedium
Q9SIS3Arabidopsis thalianasp|Q9SIS3|MA656_ARATH 65-kDa microtubule-associated protein 648.100%Swiss-ProtMedium

JBrowse

View in Genome Browser